FC925143
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of FC925143 vs. ExPASy Swiss-Prot
Match: DRE2H_ARATH (Putative dehydration-responsive element-binding protein 2H OS=Arabidopsis thaliana GN=DREB2H PE=5 SV=3) HSP 1 Score: 68.9366 bits (167), Expect = 3.300e-11 Identity = 32/59 (54.24%), Postives = 44/59 (74.58%), Query Frame = 3 Query: 333 YRGVRRRPWGKYAAEIRDPNKKGTRVWLGTFNTAVEAAKAYDNAAFKMRGRKAILNFPL 509 Y GVR+R WGK+ AEIR+P + G ++WLGTF+++ EAA AYD A+ + G+ A LN PL Sbjct: 67 YTGVRQRTWGKWVAEIREPGR-GAKLWLGTFSSSYEAALAYDEASKAIYGQSARLNLPL 124
BLAST of FC925143 vs. ExPASy Swiss-Prot
Match: ERF27_ARATH (Ethylene-responsive transcription factor ERF027 OS=Arabidopsis thaliana GN=ERF027 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 4.310e-11 Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 3 Query: 321 KERHYRGVRRRPWGKYAAEIRDPNKKGTRVWLGTFNTAVEAAKAYDNAAFKMRGRKAILNFPLEIG-----EISLDSDEVQQVDCGKKRKYEENEEFERKVAVKKEET 629 K+ YRG+R R GK+ +EIR+P +K TR+WLGT+ A AA AYD AA ++GR+A+LNFP +G E + +D K E E E+K KK + Sbjct: 15 KDPVYRGIRCRS-GKWVSEIREP-RKTTRIWLGTYPMAEMAAAAYDVAAMALKGREAVLNFPGSVGSYPVPESTSAADIRAAAAAAAAMKGCEEGEEEKKAKEKKSSS 120 The following BLAST results are available for this feature:
BLAST of FC925143 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 122
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC925143 ID=FC925143; Name=FC925143; organism=Citrus clementina; type=EST; length=757bpback to top |