FC925360
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC925360 vs. ExPASy Swiss-Prot
Match: TRXH_WHEAT (Thioredoxin H-type OS=Triticum aestivum PE=1 SV=3) HSP 1 Score: 72.7886 bits (177), Expect = 6.119e-13 Identity = 34/59 (57.63%), Postives = 44/59 (74.58%), Query Frame = 2 Query: 20 KLPNVLFLKVDVDELKSVATDWALEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHPA 196 K P +FLKVDVDELK +A +++EAMPTF+F+KEG + D+VVGA KEEL + H A Sbjct: 68 KFPAAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTTKVGLHAA 126
BLAST of FC925360 vs. ExPASy Swiss-Prot
Match: TRXH_FAGES (Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.780e-12 Identity = 35/62 (56.45%), Postives = 48/62 (77.42%), Query Frame = 2 Query: 20 KLPNVLFLKVDVDELKSVATDWALEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKH-PATA 202 K P+V F KVDVD+LK VA ++ +EAMP+F+ LKEG+ V+++VGA+K+EL IA H P TA Sbjct: 55 KFPHVAFFKVDVDDLKDVAEEYKVEAMPSFVILKEGQEVERIVGARKDELLHKIAVHAPITA 116
BLAST of FC925360 vs. ExPASy Swiss-Prot
Match: TRXH3_ARATH (Thioredoxin H-type 3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.571e-11 Identity = 31/60 (51.67%), Postives = 45/60 (75.00%), Query Frame = 2 Query: 29 NVLFLKVDVDELKSVATDWALEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHPATASA 208 +V+F KVDVDEL +VA ++ ++AMPTF+F+KEG+I + VVGA KEE+ + KH +A Sbjct: 58 DVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKHKTVVAA 117 The following BLAST results are available for this feature:
BLAST of FC925360 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC925360 ID=FC925360; Name=FC925360; organism=Citrus clementina; type=EST; length=242bpback to top |