FC925855
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC925855 vs. ExPASy Swiss-Prot
Match: DEF11_TRIKH (Defensin Tk-AMP-D1.1 OS=Triticum kiharae PE=1 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 4.080e-12 Identity = 29/47 (61.70%), Postives = 34/47 (72.34%), Query Frame = 3 Query: 144 RVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGARRRCFCSKLC 284 R C+S SH FHGACFS NCA VC+ EGF+ GKC G +R C C+K C Sbjct: 1 RDCESDSHKFHGACFSDTNCANVCQTEGFTAGKCVGVQRHCHCTKDC 47
BLAST of FC925855 vs. ExPASy Swiss-Prot
Match: DEF05_ARATH (Defensin-like protein 5 OS=Arabidopsis thaliana GN=PDF2.4 PE=2 SV=2) HSP 1 Score: 70.8626 bits (172), Expect = 5.328e-12 Identity = 29/53 (54.72%), Postives = 36/53 (67.92%), Query Frame = 3 Query: 126 MVPAEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGARRRCFCSKLC 284 +V E R C++ S+ F+G C S NCA VC NEGFS G CRG RRRC C++ C Sbjct: 24 LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC 76
BLAST of FC925855 vs. ExPASy Swiss-Prot
Match: DF322_SOLTU (Defensin-like protein P322 OS=Solanum tuberosum PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.187e-11 Identity = 30/50 (60.00%), Postives = 32/50 (64.00%), Query Frame = 3 Query: 135 AEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGARRRCFCSKLC 284 AE R C+S SH F G C NCA VC E FSGG C G RRRCFC+K C Sbjct: 25 AEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC 74 The following BLAST results are available for this feature:
BLAST of FC925855 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC925855 ID=FC925855; Name=FC925855; organism=Citrus clementina; type=EST; length=586bpback to top |