FC926015
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC926015 vs. ExPASy Swiss-Prot
Match: PG1_PEA (Plastoglobulin-1, chloroplastic OS=Pisum sativum GN=PG1 PE=1 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 3.315e-12 Identity = 32/59 (54.24%), Postives = 42/59 (71.19%), Query Frame = 1 Query: 349 IDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILV 525 ++ LK++LVD+ YGT+ G A SE RAE+ E + QLEA NPTPAP E LLN W+L+ Sbjct: 132 LEGLKRSLVDTVYGTELGFRARSEVRAEVSEFVAQLEAANPTPAPVEEPDLLNGNWVLL 190
BLAST of FC926015 vs. ExPASy Swiss-Prot
Match: PAP3_ARATH (Probable plastid-lipid-associated protein 3, chloroplastic OS=Arabidopsis thaliana GN=PAP3 PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.806e-11 Identity = 32/56 (57.14%), Postives = 40/56 (71.43%), Query Frame = 1 Query: 358 LKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILV 525 LK+ L DS YGT+ G A SE RAE++EL+ QLEA NPTPAP E LL+ W+L+ Sbjct: 153 LKRCLADSVYGTELGFKAGSEVRAEVLELVNQLEALNPTPAPLENPELLDGNWVLL 208 The following BLAST results are available for this feature:
BLAST of FC926015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC926015 ID=FC926015; Name=FC926015; organism=Citrus clementina; type=EST; length=689bpback to top |