FC928858

Overview
NameFC928858
Unique NameFC928858
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length866
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9258 contig Ccv1_Contig9258:11..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR96_ARATH (Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 1.042e-22
Identity = 55/156 (35.26%), Postives = 91/156 (58.33%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            GV  D   Y   +DGLCK G + +AL +F  L+  K E DI +Y+ +I+G+CK+G+++  W+LF SL    +  +V+ Y  MI   C  G  ++A  LF +M+  G  P+   +NTL+   +R+ + +   EL+  M     + DAST+S+V+++L
Sbjct:  460 GVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTLPNSGTYNTLIRARLRDGDKAASAELIKEMRSCGFVGDASTISMVINML 615          

HSP 2 Score: 95.1301 bits (235), Expect = 5.354e-19
Identity = 53/175 (30.29%), Postives = 88/175 (50.29%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKSQR 534
            + G+  +T  Y T I GL + G    A ++F+ +       DI +YS L+DGLCK G+L+ A  +F  L +  +  D+ TYNIMI  +C  GK++   DLF  +  KGV P+ + + T++ G  R     +   L   M E   +P++ T + ++   +++     S    K  R
Sbjct:  423 QRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTLPNSGTYNTLIRARLRDGDKAASAELIKEMR 597          

HSP 3 Score: 89.3521 bits (220), Expect = 2.938e-17
Identity = 50/154 (32.47%), Postives = 81/154 (52.60%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +T  + T I GL  +    EA+ L   +    C+ D+ +Y  +++GLCK G + +A  L   + +G + ADVV Y  +I ALC    ++ A +LF +M+ KG+ P+ V +N+L+         S    LL  M ER + P+  T S ++D  VK
Sbjct:  184 NTVTFNTLIHGLFLHNKASEAVALIDRMVARGCQPDLFTYGTVVNGLCKRGDIDLALSLLKKMEKGKIEADVVIYTTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVK 337          

HSP 4 Score: 85.1149 bits (209), Expect = 5.540e-16
Identity = 43/160 (26.88%), Postives = 82/160 (51.25%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +  +  D + Y + I+G C +  + EA  +F  +    C  ++ +Y+ LI G CK+ R++   ELF  + +  L+ + VTYN +I  L   G  D A  +F  M + GV PD + ++ L+ G  +  +  K + +   + +  + PD  T +I+++ + K
Sbjct:  353 KRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMCK 512          

HSP 5 Score: 83.5741 bits (205), Expect = 1.612e-15
Identity = 48/154 (31.17%), Postives = 78/154 (50.65%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G   D + Y T ++GLCK G I  AL L + +   K E D+  Y+ +ID LC    +  A  LF  +    +  +VVTYN +I  LC  G+   A  L  DM  + + P+ V F+ L+   ++  +  +  +L   M +R++ PD  T S +++
Sbjct:  215 GCQPDLFTYGTVVNGLCKRGDIDLALSLLKKMEKGKIEADVVIYTTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLIN 368          

HSP 6 Score: 79.7221 bits (195), Expect = 2.328e-14
Identity = 46/150 (30.67%), Postives = 76/150 (50.67%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +   ID   K G +VEA +L+  +     + DI +YS LI+G C   RL  A  +F  +       +VVTYN +I   C   ++++  +LF +M  +G+  + V +NTL+ G  +  +     ++  +M    V PD  T SI++D L K
Sbjct:  328 FSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCK 477          

HSP 7 Score: 70.0922 bits (170), Expect = 1.844e-11
Identity = 39/153 (25.49%), Postives = 76/153 (49.67%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  +   Y + I  LC  G   +A  L   +   K   ++ ++S LID   K G+L  A +L+  + +  +  D+ TY+ +I+  C   ++D+A  +F  M +K   P+ V +NTL+ G  +     + +EL   M +R ++ +  T + ++
Sbjct:  285 GIRPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLI 437          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP100_ARATH (Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 6.757e-22
Identity = 57/155 (36.77%), Postives = 90/155 (58.06%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            V  D   Y   + GLC  G +  AL +F+ L+  + EL+I  Y+ +I+G+CK+G++  AW+LF SL    +  DVVTYN MI  LC+   + +A DLF  M+  G  P+   +NTL+   +R+ + +   EL+  M     + DAST+S+V ++L
Sbjct:  464 VPTDIMTYSILLHGLCSYGKLDTALVIFKYLQKSEMELNIFIYNTMIEGMCKAGKVGEAWDLFCSLS---IKPDVVTYNTMISGLCSKRLLQEADDLFRKMKEDGTLPNSGTYNTLIRANLRDCDRAASAELIKEMRSSGFVGDASTISLVTNML 615          

HSP 2 Score: 87.0409 bits (214), Expect = 1.458e-16
Identity = 50/159 (31.45%), Postives = 85/159 (53.46%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRN-NETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   DT+ + T I GL  +    EA+ L   +    C+ D+ +Y  +++GLCK G + +A  L + +    + A+VV +N +I +LC    ++ A DLF +ME KG+ P+ V +N+L + C+ N    S    LL  M E+ + P+  T + ++D   K
Sbjct:  183 GYKPDTFTFTTLIHGLFLHNKASEAVALVDQMVQRGCQPDLVTYGTVVNGLCKRGDIDLALNLLNKMEAARIKANVVIFNTIIDSLCKYRHVEVAVDLFTEMETKGIRPNVVTYNSL-INCLCNYGRWSDASRLLSNMLEKKINPNVVTFNALIDAFFK 340          

HSP 3 Score: 83.1889 bits (204), Expect = 2.105e-15
Identity = 45/156 (28.85%), Postives = 82/156 (52.56%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + G   D   Y T ++GLCK G I  AL L   +   + + ++  ++ +ID LCK   +++A +LF  +    +  +VVTYN +I+ LC  G+   A  L  +M  K + P+ V FN L+    +  +  +  +L   M +R++ PD  T +++++
Sbjct:  216 QRGCQPDLVTYGTVVNGLCKRGDIDLALNLLNKMEAARIKANVVIFNTIIDSLCKYRHVEVAVDLFTEMETKGIRPNVVTYNSLINCLCNYGRWSDASRLLSNMLEKKINPNVVTFNALIDAFFKEGKLVEAEKLHEEMIQRSIDPDTITYNLLIN 371          

HSP 4 Score: 82.0333 bits (201), Expect = 4.690e-15
Identity = 45/155 (29.03%), Postives = 77/155 (49.68%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            + G+  +T  Y T I G  + G    A  +F+ +   +   DI +YS L+ GLC  G+L  A  +F  L +  +  ++  YN MI  +C  GK+ +A DLF  +  K   PD V +NT++ G        +  +L  +M E   +P++ T + ++
Sbjct:  426 QRGLVGNTVTYTTIIQGFFQAGDCDSAQMVFKQMVSNRVPTDIMTYSILLHGLCSYGKLDTALVIFKYLQKSEMELNIFIYNTMIEGMCKAGKVGEAWDLFCSLSIK---PDVVTYNTMISGLCSKRLLQEADDLFRKMKEDGTLPNSGTYNTLI 577          

HSP 5 Score: 73.1738 bits (178), Expect = 2.179e-12
Identity = 39/153 (25.49%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + A+   + T ID LCK  ++  A++LF  +       ++ +Y+ LI+ LC  GR   A  L  ++    +  +VVT+N +I A   +GK+ +A  L  +M  + + PD + +N L+ G   +N   +  ++   M  ++ +P+  T + +++
Sbjct:  254 IKANVVIFNTIIDSLCKYRHVEVAVDLFTEMETKGIRPNVVTYNSLINCLCNYGRWSDASRLLSNMLEKKINPNVVTFNALIDAFFKEGKLVEAEKLHEEMIQRSIDPDTITYNLLINGFCMHNRLDEAKQMFKFMVSKDCLPNIQTYNTLIN 406          

HSP 6 Score: 73.1738 bits (178), Expect = 2.179e-12
Identity = 39/153 (25.49%), Postives = 75/153 (49.02%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  +   Y + I+ LC  G   +A  L   +   K   ++ +++ LID   K G+L  A +L   + +  +  D +TYN++I+  C   ++D+A  +F  M +K   P+   +NTL+ G  +       VEL   M +R ++ +  T + ++
Sbjct:  288 GIRPNVVTYNSLINCLCNYGRWSDASRLLSNMLEKKINPNVVTFNALIDAFFKEGKLVEAEKLHEEMIQRSIDPDTITYNLLINGFCMHNRLDEAKQMFKFMVSKDCLPNIQTYNTLINGFCKCKRVEDGVELFREMSQRGLVGNTVTYTTII 440          

HSP 7 Score: 68.1662 bits (165), Expect = 7.008e-11
Identity = 41/158 (25.95%), Postives = 72/158 (45.57%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G++ D + Y  FI+  C+   +  AL +   +  L  E DI + S L++G C S R+  A  L   +       D  T+  +IH L    K  +A  L   M  +G  PD V + T++ G  +  +    + LL++M+   +  +    + ++D L K
Sbjct:  113 GISHDLYTYSIFINCFCRRSQLSLALAVLAKMMKLGYEPDIVTLSSLLNGYCHSKRISDAVALVDQMVEMGYKPDTFTFTTLIHGLFLHNKASEAVALVDQMVQRGCQPDLVTYGTVVNGLCKRGDIDLALNLLNKMEAARIKANVVIFNTIIDSLCK 270          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR94_ARATH (Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.568e-21
Identity = 52/156 (33.33%), Postives = 86/156 (55.13%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            GV  +   Y   +DGLCKNG + +A+ +F  L+    E DI +Y+ +I+G+CK+G+++  WELF +L    +  +V+ YN MI   C  G  ++A  L   M+  G  P+   +NTL+   +R+ +     EL+  M       DAST+ +V ++L
Sbjct:  463 GVHPNILTYNILLDGLCKNGKLAKAMVVFEYLQRSTMEPDIYTYNIMIEGMCKAGKVEDGWELFCNLSLKGVSPNVIAYNTMISGFCRKGSKEEADSLLKKMKEDGPLPNSGTYNTLIRARLRDGDREASAELIKEMRSCGFAGDASTIGLVTNML 618          

HSP 2 Score: 97.8265 bits (242), Expect = 8.260e-20
Identity = 53/176 (30.11%), Postives = 95/176 (53.98%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN---EISLNSIPQFKS 528
            + G+  +T  Y T I G  +      A  +F+ +  +    +I +Y+ L+DGLCK+G+L  A  +F  L R  +  D+ TYNIMI  +C  GK++   +LF ++  KGV+P+ +A+NT++ G  R     +   LL +M E   +P++ T + ++   +++   E S   I + +S
Sbjct:  426 QRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSVGVHPNILTYNILLDGLCKNGKLAKAMVVFEYLQRSTMEPDIYTYNIMIEGMCKAGKVEDGWELFCNLSLKGVSPNVIAYNTMISGFCRKGSKEEADSLLKKMKEDGPLPNSGTYNTLIRARLRDGDREASAELIKEMRS 601          

HSP 3 Score: 94.7449 bits (234), Expect = 6.992e-19
Identity = 53/158 (33.54%), Postives = 82/158 (51.90%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   DT+ + T I GL  +    EA+ L   +    C+ D+ +Y  +++GLCK G + +A  L   + +G + ADVV YN +I  LC    MD A +LF +M+ KG+ PD   +++L+         S    LL  M ER + P+  T S ++D  VK
Sbjct:  183 GYKPDTFTFTTLIHGLFLHNKASEAVALVDQMVQRGCQPDLVTYGTVVNGLCKRGDIDLALSLLKKMEKGKIEADVVIYNTIIDGLCKYKHMDDALNLFTEMDNKGIRPDVFTYSSLISCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVK 340          

HSP 4 Score: 84.3445 bits (207), Expect = 9.450e-16
Identity = 49/156 (31.41%), Postives = 79/156 (50.64%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + G   D   Y T ++GLCK G I  AL L + +   K E D+  Y+ +IDGLCK   +  A  LF  +    +  DV TY+ +I  LC  G+   A  L  DM  + + P+ V F+ L+   ++  +  +  +L   M +R++ PD  T S +++
Sbjct:  216 QRGCQPDLVTYGTVVNGLCKRGDIDLALSLLKKMEKGKIEADVVIYNTIIDGLCKYKHMDDALNLFTEMDNKGIRPDVFTYSSLISCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLIN 371          

HSP 5 Score: 83.5741 bits (205), Expect = 1.612e-15
Identity = 43/160 (26.88%), Postives = 81/160 (50.62%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +  +  D + Y + I+G C +  + EA  +F  +    C  ++ +YS LI G CK+ R++   ELF  + +  L+ + VTY  +IH        D A  +F  M + GV P+ + +N L+ G  +N + +K + +   +    + PD  T +I+++ + K
Sbjct:  356 KRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYSTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSVGVHPNILTYNILLDGLCKNGKLAKAMVVFEYLQRSTMEPDIYTYNIMIEGMCK 515          

HSP 6 Score: 75.0998 bits (183), Expect = 5.733e-13
Identity = 43/152 (28.29%), Postives = 76/152 (50.00%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            + AD   Y T IDGLCK  ++ +AL LF  +       D+ +YS LI  LC  GR   A  L   +    +  +VVT++ +I A   +GK+ +A  L+ +M  + + PD   +++L+ G   ++   +   +   M  ++  P+  T S ++
Sbjct:  254 IEADVVIYNTIIDGLCKYKHMDDALNLFTEMDNKGIRPDVFTYSSLISCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYSTLI 405          

HSP 7 Score: 72.0182 bits (175), Expect = 4.853e-12
Identity = 39/153 (25.49%), Postives = 77/153 (50.33%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  D + Y + I  LC  G   +A  L   +   K   ++ ++S LID   K G+L  A +L+  + +  +  D+ TY+ +I+  C   ++D+A  +F  M +K   P+ V ++TL+ G  +     + +EL   M +R ++ +  T + ++
Sbjct:  288 GIRPDVFTYSSLISCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYSTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYTTLI 440          

HSP 8 Score: 72.0182 bits (175), Expect = 4.853e-12
Identity = 43/151 (28.48%), Postives = 75/151 (49.67%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +   ID   K G +VEA +L+  +     + DI +YS LI+G C   RL  A  +F  +       +VVTY+ +I   C   ++++  +LF +M  +G+  + V + TL+ G  +  +      +  +M    V P+  T +I++D L KN
Sbjct:  331 FSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYSTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSVGVHPNILTYNILLDGLCKN 481          

HSP 9 Score: 68.5514 bits (166), Expect = 5.366e-11
Identity = 42/158 (26.58%), Postives = 72/158 (45.57%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G++ D + Y  FI+  C+   +  AL +   +  L  E DI + S L++G C S R+  A  L   +       D  T+  +IH L    K  +A  L   M  +G  PD V + T++ G  +  +    + LL +M++  +  D    + ++D L K
Sbjct:  113 GISHDLYTYSIFINCFCRRSQLSLALAVLAKMMKLGYEPDIVTLSSLLNGYCHSKRISDAVALVDQMVEMGYKPDTFTFTTLIHGLFLHNKASEAVALVDQMVQRGCQPDLVTYGTVVNGLCKRGDIDLALSLLKKMEKGKIEADVVIYNTIIDGLCK 270          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR97_ARATH (Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.353e-21
Identity = 53/156 (33.97%), Postives = 87/156 (55.77%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            GV  D   Y   +DGLC NG +  AL +F  ++    +LDI +Y+ +I+ LCK+G+++  W+LF SL    +  +VVTY  M+   C  G  ++A  LF++M+  G  P+   +NTL+   +R+ + +   EL+  M       DAST  +V ++L
Sbjct:  421 GVHPDIMTYNILLDGLCNNGNVETALVVFEYMQKRDMKLDIVTYTTMIEALCKAGKVEDGWDLFCSLSLKGVKPNVVTYTTMMSGFCRKGLKEEADALFVEMKEDGPLPNSGTYNTLIRARLRDGDEAASAELIKEMRSCGFAGDASTFGLVTNML 576          

HSP 2 Score: 99.7525 bits (247), Expect = 2.174e-20
Identity = 55/158 (34.81%), Postives = 81/158 (51.27%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   DT  + T + GL ++    EA+ L   + +  C+ D+ +Y  +I+GLCK G   +A  L + + +G + ADVV YN +I  LC    MD A DLF  ME KG+ PD   +N L+         S    LL  M E+N+ PD    + ++D  VK
Sbjct:  175 GYQPDTVTFTTLVHGLFQHNKASEAVALVERMVVKGCQPDLVTYGAVINGLCKRGEPDLALNLLNKMEKGKIEADVVIYNTIIDGLCKYKHMDDAFDLFNKMETKGIKPDVFTYNPLISCLCNYGRWSDASRLLSDMLEKNINPDLVFFNALIDAFVK 332          

HSP 3 Score: 85.5001 bits (210), Expect = 4.242e-16
Identity = 50/175 (28.57%), Postives = 84/175 (48.00%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKSQR 534
            + G+  +T  Y T I G  +      A  +F+ +       DI +Y+ L+DGLC +G ++ A  +F  + +  +  D+VTY  MI ALC  GK++   DLF  +  KGV P+ V + T+M G  R     +   L   M E   +P++ T + ++   +++     S    K  R
Sbjct:  384 QRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSDGVHPDIMTYNILLDGLCNNGNVETALVVFEYMQKRDMKLDIVTYTTMIEALCKAGKVEDGWDLFCSLSLKGVKPNVVTYTTMMSGFCRKGLKEEADALFVEMKEDGPLPNSGTYNTLIRARLRDGDEAASAELIKEMR 558          

HSP 4 Score: 80.1073 bits (196), Expect = 1.782e-14
Identity = 49/154 (31.82%), Postives = 74/154 (48.05%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRM-DERNVIPDASTLSIVV 474
            G   D   Y   I+GLCK G    AL L   +   K E D+  Y+ +IDGLCK   +  A++LF+ +    +  DV TYN +I  LC  G+   A  L  DM  K + PD V FN L+   ++  +  +  +L   M   ++  PD    + ++
Sbjct:  210 GCQPDLVTYGAVINGLCKRGEPDLALNLLNKMEKGKIEADVVIYNTIIDGLCKYKHMDDAFDLFNKMETKGIKPDVFTYNPLISCLCNYGRWSDASRLLSDMLEKNINPDLVFFNALIDAFVKEGKLVEAEKLYDEMVKSKHCFPDVVAYNTLI 363          

HSP 5 Score: 76.2554 bits (186), Expect = 2.574e-13
Identity = 43/151 (28.48%), Postives = 74/151 (49.01%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELF-RTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +   ID   K G +VEA +L+   ++   C  D+ +Y+ LI G CK  R++   E+F  + +  L+ + VTY  +IH        D A  +F  M + GV PD + +N L+ G   N      + +   M +R++  D  T + +++ L K
Sbjct:  323 FNALIDAFVKEGKLVEAEKLYDEMVKSKHCFPDVVAYNTLIKGFCKYKRVEEGMEVFREMSQRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSDGVHPDIMTYNILLDGLCNNGNVETALVVFEYMQKRDMKLDIVTYTTMIEALCK 473          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP247_ARATH (Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 7.470e-21
Identity = 55/156 (35.26%), Postives = 83/156 (53.21%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            GV      Y   +DGLC NG + +ALE+F  ++  +  L I  Y+ +I G+C + ++  AW LF SL    +  DVVTYN+MI  LC  G + +A  LF  M+  G  PD   +N L+   +  +     VEL+  M       D+ST+ +V+D+L
Sbjct:  450 GVPPSVVTYGILLDGLCDNGELNKALEIFEKMQKSRMTLGIGIYNIIIHGMCNASKVDDAWSLFCSLSDKGVKPDVVTYNVMIGGLCKKGSLSEADMLFRKMKEDGCTPDDFTYNILIRAHLGGSGLISSVELIEEMKVCGFSADSSTIKMVIDML 605          

HSP 2 Score: 100.523 bits (249), Expect = 1.274e-20
Identity = 50/153 (32.68%), Postives = 82/153 (53.59%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+A DT  Y + IDG CK   + EA ++F  +    CE DI +YS LI+  CK+ R+     LF  +    LI + +TYN ++   C  GK++ A +LF +M ++GV P  V +  L+ G   N E +K +E+  +M +  +       +I++
Sbjct:  345 GIAPDTITYNSLIDGFCKENCLHEANQMFDLMVSKGCEPDIVTYSILINSYCKAKRVDDGMRLFREISSKGLIPNTITYNTLVLGFCQSGKLNAAKELFQEMVSRGVPPSVVTYGILLDGLCDNGELNKALEIFEKMQKSRMTLGIGIYNIII 497          

HSP 3 Score: 98.5969 bits (244), Expect = 4.842e-20
Identity = 54/148 (36.49%), Postives = 83/148 (56.08%), Query Frame = 1
Query:   46 TFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            T I+GLC  G + EAL L   +     + D  +Y  +++ LCKSG   +A +LF  +    + A VV Y+I+I +LC DG  D A  LF +ME KG+  D V +++L+ G   + +     ++L  M  RN+IPD  T S ++D+ VK
Sbjct:  180 TLINGLCLKGRVSEALVLIDRMVEYGFQPDEVTYGPVLNRLCKSGNSALALDLFRKMEERNIKASVVQYSIVIDSLCKDGSFDDALSLFNEMEMKGIKADVVTYSSLIGGLCNDGKWDDGAKMLREMIGRNIIPDVVTFSALIDVFVK 327          

HSP 4 Score: 95.5153 bits (236), Expect = 4.099e-19
Identity = 49/153 (32.03%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  +T  Y T + G C++G +  A ELF+ +        + +Y  L+DGLC +G L  A E+F  + +  +   +  YNI+IH +C   K+D A  LF  +  KGV PD V +N ++ G  +    S+   L  +M E    PD  T +I++
Sbjct:  415 GLIPNTITYNTLVLGFCQSGKLNAAKELFQEMVSRGVPPSVVTYGILLDGLCDNGELNKALEIFEKMQKSRMTLGIGIYNIIIHGMCNASKVDDAWSLFCSLSDKGVKPDVVTYNVMIGGLCKKGSLSEADMLFRKMKEDGCTPDDFTYNILI 567          

HSP 5 Score: 92.4337 bits (228), Expect = 3.470e-18
Identity = 50/155 (32.26%), Postives = 79/155 (50.97%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            +G   D   Y   ++ LCK+G    AL+LFR +     +  +  YS +ID LCK G    A  LF+ +    + ADVVTY+ +I  LC DGK D    +  +M  + + PD V F+ L+   ++  +  +  EL + M  R + PD  T + ++D
Sbjct:  204 YGFQPDEVTYGPVLNRLCKSGNSALALDLFRKMEERNIKASVVQYSIVIDSLCKDGSFDDALSLFNEMEMKGIKADVVTYSSLIGGLCNDGKWDDGAKMLREMIGRNIIPDVVTFSALIDVFVKEGKLLEAKELYNEMITRGIAPDTITYNSLID 358          

HSP 6 Score: 88.5817 bits (218), Expect = 5.011e-17
Identity = 47/157 (29.94%), Postives = 83/157 (52.87%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            + A    Y   ID LCK+G   +AL LF  + +   + D+ +YS LI GLC  G+     ++   +    +I DVVT++ +I     +GK+ +A +L+ +M  +G+APD + +N+L+ G  + N   +  ++   M  +   PD  T SI+++   K
Sbjct:  241 IKASVVQYSIVIDSLCKDGSFDDALSLFNEMEMKGIKADVVTYSSLIGGLCNDGKWDDGAKMLREMIGRNIIPDVVTFSALIDVFVKEGKLLEAKELYNEMITRGIAPDTITYNSLIDGFCKENCLHEANQMFDLMVSKGCEPDIVTYSILINSYCK 397          

HSP 7 Score: 87.0409 bits (214), Expect = 1.458e-16
Identity = 49/158 (31.01%), Postives = 81/158 (51.27%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +  D   +   ID   K G ++EA EL+  +       D  +Y+ LIDG CK   L  A ++F  +       D+VTY+I+I++ C   ++D    LF ++ +KG+ P+ + +NTL+LG  ++ + +   EL   M  R V P   T  I++D L  N
Sbjct:  311 IIPDVVTFSALIDVFVKEGKLLEAKELYNEMITRGIAPDTITYNSLIDGFCKENCLHEANQMFDLMVSKGCEPDIVTYSILINSYCKAKRVDDGMRLFREISSKGLIPNTITYNTLVLGFCQSGKLNAAKELFQEMVSRGVPPSVVTYGILLDGLCDN 468          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR12_ARATH (Pentatricopeptide repeat-containing protein At1g05665, mitochondrial OS=Arabidopsis thaliana GN=At1g05665 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.409e-19
Identity = 55/162 (33.95%), Postives = 88/162 (54.32%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTL-SIVVDLLVKNEI 498
            G + +   Y T IDGLCK G +  A EL   +  +  + +I +Y+ +++GLCKSG ++ A +L        L AD VTY  ++ A C  G+MDKA ++  +M  KG+ P  V FN LM G   +       +LL+ M  + + P+A+T  S+V    ++N +
Sbjct:  451 GCSPNVVTYTTLIDGLCKEGDLDSANELLHEMWKIGLQPNIFTYNSIVNGLCKSGNIEEAVKLVGEFEAAGLNADTVTYTTLMDAYCKSGEMDKAQEILKEMLGKGLQPTIVTFNVLMNGFCLHGMLEDGEKLLNWMLAKGIAPNATTFNSLVKQYCIRNNL 612          

HSP 2 Score: 87.8113 bits (216), Expect = 8.547e-17
Identity = 47/154 (30.52%), Postives = 83/154 (53.90%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G+  D+  +   I+G CK G++ +A  +   +    C  ++ +Y+ LIDGLCK G L  A EL H + +  L  ++ TYN +++ LC  G +++A  L  + EA G+  D V + TLM    ++ E  K  E+L  M  + + P   T +++++
Sbjct:  416 GLEPDSVTFTELINGYCKAGHMKDAFRVHNHMIQAGCSPNVVTYTTLIDGLCKEGDLDSANELLHEMWKIGLQPNIFTYNSIVNGLCKSGNIEEAVKLVGEFEAAGLNADTVTYTTLMDAYCKSGEMDKAQEILKEMLGKGLQPTIVTFNVLMN 569          

HSP 3 Score: 85.1149 bits (209), Expect = 5.540e-16
Identity = 51/161 (31.68%), Postives = 79/161 (49.07%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            R G+  DT  Y T IDG CK G I  A + F  +       D+ +Y+ +I G C+ G +  A +LFH +    L  D VT+  +I+  C  G M  A  +   M   G +P+ V + TL+ G  +  +     ELLH M +  + P+  T + +V+ L K+
Sbjct:  344 RQGILPDTVVYTTLIDGFCKRGDIRAASKFFYEMHSRDITPDVLTYTAIISGFCQIGDMVEAGKLFHEMFCKGLEPDSVTFTELINGYCKAGHMKDAFRVHNHMIQAGCSPNVVTYTTLIDGLCKEGDLDSANELLHEMWKIGLQPNIFTYNSIVNGLCKS 504          

HSP 4 Score: 84.3445 bits (207), Expect = 9.450e-16
Identity = 49/154 (31.82%), Postives = 78/154 (50.65%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLG-CIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  + + Y + ++GLCK+G I EA++L           D  +Y+ L+D  CKSG +  A E+   +    L   +VT+N++++  C  G ++    L   M AKG+AP+   FN+L+   CIRNN       +   M  R V PD  T   +V
Sbjct:  486 GLQPNIFTYNSIVNGLCKSGNIEEAVKLVGEFEAAGLNADTVTYTTLMDAYCKSGEMDKAQEILKEMLGKGLQPTIVTFNVLMNGFCLHGMLEDGEKLLNWMLAKGIAPNATTFNSLVKQYCIRNN-LKAATAIYKDMCSRGVGPDGKTYENLV 638          

HSP 5 Score: 81.2629 bits (199), Expect = 8.000e-15
Identity = 43/158 (27.22%), Postives = 83/158 (52.53%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +  D   Y   I G C+ G +VEA +LF  +     E D  +++ LI+G CK+G +K A+ + + + +     +VVTY  +I  LC +G +D A++L  +M   G+ P+   +N+++ G  ++    + V+L+   +   +  D  T + ++D   K+
Sbjct:  382 ITPDVLTYTAIISGFCQIGDMVEAGKLFHEMFCKGLEPDSVTFTELINGYCKAGHMKDAFRVHNHMIQAGCSPNVVTYTTLIDGLCKEGDLDSANELLHEMWKIGLQPNIFTYNSIVNGLCKSGNIEEAVKLVGEFEAAGLNADTVTYTTLMDAYCKS 539          

HSP 6 Score: 76.2554 bits (186), Expect = 2.574e-13
Identity = 42/153 (27.45%), Postives = 74/153 (48.37%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            GV  +  +Y   I  +C+ G I EA  L   + +     D+ SYS +++G C+ G L   W+L   + R  L  +   Y  +I  LC   K+ +A + F +M  +G+ PD V + TL+ G  +  +     +  + M  R++ PD  T + ++
Sbjct:  241 GVCWNVASYNIVIHFVCQLGRIKEAHHLLLLMELKGYTPDVISYSTVVNGYCRFGELDKVWKLIEVMKRKGLKPNSYIYGSIIGLLCRICKLAEAEEAFSEMIRQGILPDTVVYTTLIDGFCKRGDIRAASKFFYEMHSRDITPDVLTYTAII 393          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR2_ARATH (Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 1.840e-19
Identity = 47/160 (29.38%), Postives = 93/160 (58.13%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGV--LIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDE--RNVIPDASTLSIVV 474
            R +GV  D++ + T I+G CKN  + EA  +F+ + +  C  D+ +Y+ +IDGLC++G++KIA  +   + +    +  +VV+Y  ++   C   ++D+A  +F DM ++G+ P+ V +NTL+ G    +   ++ ++L   ++      PDA T +I++
Sbjct:  201 RTYGVTPDSYTFNTLINGFCKNSMVDEAFRIFKDMELYHCNPDVVTYNTIIDGLCRAGKVKIAHNVLSGMLKKATDVHPNVVSYTTLVRGYCMKQEIDEAVLVFHDMLSRGLKPNAVTYNTLIKGLSEAHRYDEIKDILIGGNDAFTTFAPDACTFNILI 360          

HSP 2 Score: 70.8626 bits (172), Expect = 1.081e-11
Identity = 50/163 (30.67%), Postives = 76/163 (46.63%), Query Frame = 1
Query:   22 AADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSL-PRGVLIAD------VVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            A D   +   I   C  G++  A+++F+ +  +K   D  SYS LI  LC       A  LF+ L  + VL+           YN M   LCA+GK  +A  +F  +  +GV  D  ++ TL+ G  R  +     ELL  M  R  +PD  T  +++D L+K
Sbjct:  350 APDACTFNILIKAHCDAGHLDAAMKVFQEMLNMKLHPDSASYSVLIRTLCMRNEFDRAETLFNELFEKEVLLGKDECKPLAAAYNPMFEYLCANGKTKQAEKVFRQLMKRGV-QDPPSYKTLITGHCREGKFKPAYELLVLMLRREFVPDLETYELLIDGLLK 511          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP409_ARATH (Pentatricopeptide repeat-containing protein At5g40400 OS=Arabidopsis thaliana GN=At5g40400 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.354e-19
Identity = 48/168 (28.57%), Postives = 89/168 (52.98%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSI 513
            R G+  +T+ +    +  C +    E  +    +     E D+ +Y+ L+   C+ GRLK A+ L+  + R  ++ D+VTY  +I  LC DG++ +AH  F  M  +G+ PDC+++NTL+    +     +  +LLH M   +V+PD  T  ++V+  V+    L+++
Sbjct:  229 RVGIHPNTYTFNILTNVFCNDSNFREVDDFLEKMEEEGFEPDLVTYNTLVSSYCRRGRLKEAFYLYKIMYRRRVVPDLVTYTSLIKGLCKDGRVREAHQTFHRMVDRGIKPDCMSYNTLIYAYCKEGMMQQSKKLLHEMLGNSVVPDRFTCKVIVEGFVREGRLLSAV 396          

HSP 2 Score: 74.7146 bits (182), Expect = 7.488e-13
Identity = 38/134 (28.36%), Postives = 65/134 (48.51%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELL 417
            G   D   Y T +   C+ G + EA  L++ +   +   D+ +Y+ LI GLCK GR++ A + FH +    +  D ++YN +I+A C +G M ++  L  +M    V PD      ++ G +R       V  +
Sbjct:  266 GFEPDLVTYNTLVSSYCRRGRLKEAFYLYKIMYRRRVVPDLVTYTSLIKGLCKDGRVREAHQTFHRMVDRGIKPDCMSYNTLIYAYCKEGMMQQSKKLLHEMLGNSVVPDRFTCKVIVEGFVREGRLLSAVNFV 399          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: RF1_ORYSI (Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 9.132e-19
Identity = 48/171 (28.07%), Postives = 97/171 (56.73%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKS 528
            G+  +T  + + ID  CK G ++E+ +LF  +  +  + ++ +Y+ LI+G C +G++  A +L   +    L  + VTY+ +I+  C   +M+ A  LF +ME+ GV+PD + +N ++ G  +   T+   EL  R+ E     + ST +I++  L KN+++ +++  F++
Sbjct:  471 GICLNTIFFNSIIDSHCKEGRVIESEKLFELMVRIGVKPNVITYNTLINGYCLAGKMDEAMKLLSGMVSVGLKPNTVTYSTLINGYCKISRMEDALVLFKEMESSGVSPDIITYNIILQGLFQTRRTAAAKELYVRITESGTQIELSTYNIILHGLCKNKLTDDALQMFQN 641          

HSP 2 Score: 92.0485 bits (227), Expect = 4.532e-18
Identity = 57/163 (34.97%), Postives = 85/163 (52.15%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTL---RILKCELDIRSYSCLIDGLCKSGRLKIAWELFHS-LPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            G   + ++Y   + GLC      EALEL   +   R      D+ SY+ +I+G  K G    A+  +H  L RG+L  DVVTYN +I ALC    MDKA ++   M   GV PDC+ +N+++ G   + +  + +  L +M    V PD  T S+++D L KN
Sbjct:  153 GCIPNVFSYNILLKGLCDENRSQEALELLHMMADDRGGGSPPDVVSYTTVINGFFKEGDSDKAYSTYHEMLDRGIL-PDVVTYNSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILHGYCSSGQPKEAIGFLKKMRSDGVEPDVVTYSLLMDYLCKN 314          

HSP 3 Score: 83.9593 bits (206), Expect = 1.234e-15
Identity = 46/156 (29.49%), Postives = 81/156 (51.92%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            G   +   Y   + GLCKN    +AL++F+ L ++  +L+ R+++ +ID L K GR   A +LF +     L+ +  TY +M   +   G +++   LFL ME  G   D    N ++   ++  E ++    L  +DE++   +AST S+ +DLL
Sbjct:  611 GTQIELSTYNIILHGLCKNKLTDDALQMFQNLCLMDLKLEARTFNIMIDALLKVGRNDEAKDLFVAFSSNGLVPNYWTYRLMAENIIGQGLLEELDQLFLSMEDNGCTVDSGMLNFIVRELLQRGEITRAGTYLSMIDEKHFSLEASTASLFIDLL 766          

HSP 4 Score: 80.8777 bits (198), Expect = 1.045e-14
Identity = 43/161 (26.71%), Postives = 81/161 (50.31%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            ++GV  D   Y + + G C +G   EA+   + +R    E D+ +YS L+D LCK+GR   A ++F S+ +  L  ++ TY  ++      G + + H L   M   G+ PD   F+ L+    +  +  + + +  +M ++ + P+A T   V+ +L K+
Sbjct:  259 KNGVMPDCMTYNSILHGYCSSGQPKEAIGFLKKMRSDGVEPDVVTYSLLMDYLCKNGRCMEARKIFDSMTKRGLKPEITTYGTLLQGYATKGALVEMHGLLDLMVRNGIHPDHYVFSILICAYAKQGKVDQAMLVFSKMRQQGLNPNAVTYGAVIGILCKS 419          

HSP 5 Score: 74.7146 bits (182), Expect = 7.488e-13
Identity = 42/160 (26.25%), Postives = 82/160 (51.25%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            R GV  +   Y T I+G C  G + EA++L   +  +  + +  +YS LI+G CK  R++ A  LF  +    +  D++TYNI++  L    +   A +L++ +   G   +   +N ++ G  +N  T   +++   +   ++  +A T +I++D L+K
Sbjct:  504 RIGVKPNVITYNTLINGYCLAGKMDEAMKLLSGMVSVGLKPNTVTYSTLINGYCKISRMEDALVLFKEMESSGVSPDIITYNIILQGLFQTRRTAAAKELYVRITESGTQIELSTYNIILHGLCKNKLTDDALQMFQNLCLMDLKLEARTFNIMIDALLK 663          

HSP 6 Score: 68.9366 bits (167), Expect = 4.109e-11
Identity = 39/151 (25.83%), Postives = 74/151 (49.01%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDAST 459
            R  G   D  +Y T I+G  K G   +A   +  +       D+ +Y+ +I  LCK+  +  A E+ +++ +  ++ D +TYN ++H  C+ G+  +A      M + GV PD V ++ LM    +N    +  ++   M +R + P+ +T
Sbjct:  188 RGGGSPPDVVSYTTVINGFFKEGDSDKAYSTYHEMLDRGILPDVVTYNSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILHGYCSSGQPKEAIGFLKKMRSDGVEPDVVTYSLLMDYLCKNGRCMEARKIFDSMTKRGLKPEITT 338          

HSP 7 Score: 68.1662 bits (165), Expect = 7.008e-11
Identity = 43/163 (26.38%), Postives = 81/163 (49.69%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV-DLLVKNEIS 501
            GV+ D   Y   + GL +      A EL+  +     ++++ +Y+ ++ GLCK+     A ++F +L    L  +  T+NIMI AL   G+ D+A DLF+   + G+ P+   +  +    I      ++ +L   M++     D+  L+ +V +LL + EI+
Sbjct:  576 GVSPDIITYNIILQGLFQTRRTAAAKELYVRITESGTQIELSTYNIILHGLCKNKLTDDALQMFQNLCLMDLKLEARTFNIMIDALLKVGRNDEAKDLFVAFSSNGLVPNYWTYRLMAENIIGQGLLEELDQLFLSMEDNGCTVDSGMLNFIVRELLQRGEIT 738          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP213_ARATH (Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 9.132e-19
Identity = 51/159 (32.08%), Postives = 81/159 (50.94%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            G+  D + Y T I G+CK G +  A E+ R L +  CE D+ SY+ L+  L   G+ +   +L   +       +VVTY+I+I  LC DGK+++A +L   M+ KG+ PD  +++ L+    R       +E L  M     +PD    + V+  L KN
Sbjct:  258 GLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELKGCEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEAMNLLKLMKEKGLTPDAYSYDPLIAAFCREGRLDVAIEFLETMISDGCLPDIVNYNTVLATLCKN 416          

HSP 2 Score: 78.5666 bits (192), Expect = 5.185e-14
Identity = 44/154 (28.57%), Postives = 75/154 (48.70%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G   D   Y T +  LCKNG   +ALE+F  L  + C  +  SY+ +   L  SG    A  +   +    +  D +TYN MI  LC +G +D+A +L +DM +    P  V +N ++LG  + +     + +L  M      P+ +T +++++
Sbjct:  398 GCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSSGDKIRALHMILEMMSNGIDPDEITYNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTYNIVLLGFCKAHRIEDAINVLESMVGNGCRPNETTYTVLIE 551          

HSP 3 Score: 77.7962 bits (190), Expect = 8.845e-14
Identity = 41/153 (26.80%), Postives = 78/153 (50.98%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLV 486
            D +AY   I+G CK   I +A  +   +R      D  +Y+ +I  LC  G+L +A ++ + L        V+TY I+I A   +G +D+A  L  +M ++G+ PD   +NT++ G  +     +  E++  ++ +   PD  + +I++  L+
Sbjct:  157 DVFAYNALINGFCKMNRIDDATRVLDRMRSKDFSPDTVTYNIMIGSLCSRGKLDLALKVLNQLLSDNCQPTVITYTILIEATMLEGGVDEALKLMDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELKGCEPDVISYNILLRALL 309          

HSP 4 Score: 77.411 bits (189), Expect = 1.155e-13
Identity = 40/150 (26.67%), Postives = 75/150 (50.00%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            Y   I  LC++G I EA+ L + ++      D  SY  LI   C+ GRL +A E   ++     + D+V YN ++  LC +GK D+A ++F  +   G +P+  ++NT+      + +  + + ++  M    + PD  T + ++  L +
Sbjct:  336 YSILITTLCRDGKIEEAMNLLKLMKEKGLTPDAYSYDPLIAAFCREGRLDVAIEFLETMISDGCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSSGDKIRALHMILEMMSNGIDPDEITYNSMISCLCR 485          

HSP 5 Score: 76.2554 bits (186), Expect = 2.574e-13
Identity = 42/162 (25.93%), Postives = 79/162 (48.77%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            R    + DT  Y   I  LC  G +  AL++   L    C+  + +Y+ LI+     G +  A +L   +    L  D+ TYN +I  +C +G +D+A ++  ++E KG  PD +++N L+   +   +  +  +L+ +M      P+  T SI++  L ++
Sbjct:  185 RSKDFSPDTVTYNIMIGSLCSRGKLDLALKVLNQLLSDNCQPTVITYTILIEATMLEGGVDEALKLMDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELKGCEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRD 346          

HSP 6 Score: 70.8626 bits (172), Expect = 1.081e-11
Identity = 43/156 (27.56%), Postives = 74/156 (47.44%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            +  G+  D ++Y   I   C+ G +  A+E   T+    C  DI +Y+ ++  LCK+G+   A E+F  L       +  +YN M  AL + G   +A  + L+M + G+ PD + +N+++    R     +  ELL  M      P   T +IV+
Sbjct:  360 KEKGLTPDAYSYDPLIAAFCREGRLDVAIEFLETMISDGCLPDIVNYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSSGDKIRALHMILEMMSNGIDPDEITYNSMISCLCREGMVDEAFELLVDMRSCEFHPSVVTYNIVL 515          

HSP 7 Score: 68.9366 bits (167), Expect = 4.109e-11
Identity = 39/138 (28.26%), Postives = 71/138 (51.45%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDA 453
            Y   I+     G + EAL+L   +     + D+ +Y+ +I G+CK G +  A+E+  +L       DV++YNI++ AL   GK ++   L   M ++   P+ V ++ L+    R+ +  + + LL  M E+ + PDA
Sbjct:  231 YTILIEATMLEGGVDEALKLMDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMVRNLELKGCEPDVISYNILLRALLNQGKWEEGEKLMTKMFSEKCDPNVVTYSILITTLCRDGKIEEAMNLLKLMKEKGLTPDA 368          
The following BLAST results are available for this feature:
BLAST of FC928858 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
PPR96_ARATH1.042e-2235.26Pentatricopeptide repeat-containing protein At1g62... [more]
PP100_ARATH6.757e-2236.77Pentatricopeptide repeat-containing protein At1g63... [more]
PPR94_ARATH2.568e-2133.33Pentatricopeptide repeat-containing protein At1g62... [more]
PPR97_ARATH3.353e-2133.97Pentatricopeptide repeat-containing protein At1g63... [more]
PP247_ARATH7.470e-2135.26Pentatricopeptide repeat-containing protein At3g22... [more]
PPR12_ARATH1.409e-1933.95Pentatricopeptide repeat-containing protein At1g05... [more]
PPR2_ARATH1.840e-1929.38Pentatricopeptide repeat-containing protein At1g02... [more]
PP409_ARATH5.354e-1928.57Pentatricopeptide repeat-containing protein At5g40... [more]
RF1_ORYSI9.132e-1928.07Protein Rf1, mitochondrial OS=Oryza sativa subsp. ... [more]
PP213_ARATH9.132e-1932.08Pentatricopeptide repeat-containing protein At3g04... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1CB01RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CB01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928858 ID=FC928858|Name=FC928858|organism=Citrus clementina|type=EST|length=866bp
GGCACGAGGCGTCATGGCGTGGCAGCTGATACCTGGGCATATAGAACCTT
TATTGATGGGCTCTGCAAGAATGGTTATATTGTAGAGGCACTTGAACTAT
TTCGTACTTTGAGAATTCTCAAGTGTGAACTTGATATTCGATCCTACAGC
TGCCTCATTGATGGATTATGTAAATCCGGCAGACTCAAAATTGCATGGGA
ACTATTTCATAGTTTGCCTCGTGGAGTCCTAATAGCAGATGTTGTAACAT
ATAACATCATGATCCATGCGCTTTGTGCTGATGGAAAAATGGACAAGGCA
CATGATTTGTTTCTTGATATGGAAGCAAAAGGTGTAGCACCCGATTGTGT
CGCATTTAACACGCTGATGCTAGGTTGCATCCGCAATAATGAGACATCAA
AAGTTGTTGAACTCCTTCACAGAATGGATGAGAGAAATGTGATACCAGAT
GCATCTACACTTTCAATTGTTGTGGACTTACTTGTAAAGAATGAAATTAG
CTTAAACTCCATTCCACAATTCAAGAGTCAAAGGTAAGTGAGTTTAATAT
TGATTTAGTCGCATGTTTCTTCTGCCTGAAAACCCGATCTGGAGGATCCC
ATTCTTATTAACACGTGTAAAGGAGTGTTGTCTAATGTTGGCATGTTCCT
AGGTTCTGTCCATGGATTCTGTTTGCAGACATGGCTAACTTCTTGTCCAA
CAGATAAGTTTTAAAGTCTTTCAACTTTATGTTGTAAAATAACATTTTCA
TTATTCAATTCATGAGTTTTCCTTCTGTATCACATACTTCTCATTAGCTG
GAAGCGCAAATTTTTTAGGCTTTTCCTGTATGGCCTCTTTTTCTGCTCTA
AATAAAATGGCATTTT
back to top