FC928858

Overview
NameFC928858
Unique NameFC928858
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length866
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9258 contig Ccv1_Contig9258:11..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP306_ARATH (Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.193e-18
Identity = 46/160 (28.75%), Postives = 89/160 (55.62%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            GV  + + Y   ++ LCK+G   +A ++F  +R      +I +Y+ LI GLC+  +L  A ++   +    +  +++TYN +I   C  GK+ KA  L  D++++G++P  V +N L+ G  R  +TS   +++  M+ER + P   T +I++D   +++
Sbjct:  263 GVFPNLYTYNCVMNQLCKDGRTKDAFQVFDEMRERGVSCNIVTYNTLIGGLCREMKLNEANKVVDQMKSDGINPNLITYNTLIDGFCGVGKLGKALSLCRDLKSRGLSPSLVTYNILVSGFCRKGDTSGAAKMVKEMEERGIKPSKVTYTILIDTFARSD 422          

HSP 2 Score: 86.6557 bits (213), Expect = 1.904e-16
Identity = 46/154 (29.87%), Postives = 86/154 (55.84%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G + +   Y T IDG CK G I +A +LF  +  L    + R+Y+ LI+GL K+G  K  +E++  +    +  ++ TYN +++ LC DG+   A  +F +M  +GV+ + V +NTL+ G  R  + ++  +++ +M    + P+  T + ++D
Sbjct:  193 GFSPNVVIYTTLIDGCCKKGEIEKAKDLFFEMGKLGLVANERTYTVLINGLFKNGVKKQGFEMYEKMQEDGVFPNLYTYNCVMNQLCKDGRTKDAFQVFDEMRERGVSCNIVTYNTLIGGLCREMKLNEANKVVDQMKSDGINPNLITYNTLID 346          

HSP 3 Score: 82.8037 bits (203), Expect = 2.750e-15
Identity = 46/156 (29.49%), Postives = 78/156 (50.00%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            R  GV+ +   Y T I GLC+   + EA ++   ++      ++ +Y+ LIDG C  G+L  A  L   L    L   +VTYNI++   C  G    A  +  +ME +G+ P  V +  L+    R++   K ++L   M+E  ++PD  T S+++
Sbjct:  295 RERGVSCNIVTYNTLIGGLCREMKLNEANKVVDQMKSDGINPNLITYNTLIDGFCGVGKLGKALSLCRDLKSRGLSPSLVTYNILVSGFCRKGDTSGAAKMVKEMEERGIKPSKVTYTILIDTFARSDNMEKAIQLRLSMEELGLVPDVHTYSVLI 450          

HSP 4 Score: 82.4185 bits (202), Expect = 3.591e-15
Identity = 43/165 (26.06%), Postives = 86/165 (52.12%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEIS 501
            +  G++     Y   + G C+ G    A ++ + +     +    +Y+ LID   +S  ++ A +L  S+    L+ DV TY+++IH  C  G+M++A  LF  M  K   P+ V +NT++LG  +   + + ++LL  M+E+ + P+ ++   ++++L K   S
Sbjct:  365 KSRGLSPSLVTYNILVSGFCRKGDTSGAAKMVKEMEERGIKPSKVTYTILIDTFARSDNMEKAIQLRLSMEELGLVPDVHTYSVLIHGFCIKGQMNEASRLFKSMVEKNCEPNEVIYNTMILGYCKEGSSYRALKLLKEMEEKELAPNVASYRYMIEVLCKERKS 529          

HSP 5 Score: 72.4034 bits (176), Expect = 3.716e-12
Identity = 46/174 (26.44%), Postives = 86/174 (49.43%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNS----IPQFKS 528
            V  D +++   I G C+ G I ++ +L   L       ++  Y+ LIDG CK G ++ A +LF  + +  L+A+  TY ++I+ L  +G   +  +++  M+  GV P+   +N +M    ++  T    ++   M ER V  +  T + ++  L + E+ LN     + Q KS
Sbjct:  159 VVLDVYSFGILIKGCCEAGEIEKSFDLLIELTEFGFSPNVVIYTTLIDGCCKKGEIEKAKDLFFEMGKLGLVANERTYTVLINGLFKNGVKKQGFEMYEKMQEDGVFPNLYTYNCVMNQLCKDGRTKDAFQVFDEMRERGVSCNIVTYNTLIGGLCR-EMKLNEANKVVDQMKS 331          

HSP 6 Score: 68.1662 bits (165), Expect = 7.008e-11
Identity = 38/138 (27.54%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  121 KCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKSQR 534
            K  LD+ S+  LI G C++G ++ +++L   L       +VV Y  +I   C  G+++KA DLF +M   G+  +   +  L+ G  +N    +  E+  +M E  V P+  T + V++ L K+  + ++   F   R
Sbjct:  158 KVVLDVYSFGILIKGCCEAGEIEKSFDLLIELTEFGFSPNVVIYTTLIDGCCKKGEIEKAKDLFFEMGKLGLVANERTYTVLINGLFKNGVKKQGFEMYEKMQEDGVFPNLYTYNCVMNQLCKDGRTKDAFQVFDEMR 295          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP218_ARATH (Pentatricopeptide repeat-containing protein At3g07290, mitochondrial OS=Arabidopsis thaliana GN=At3g07290 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.034e-18
Identity = 50/158 (31.65%), Postives = 82/158 (51.90%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G    T  Y   I  LC  G I +A  LF  +    C+ ++ +Y+ LIDGLC+ G+++ A  +   + +  +   V+TYN +I+  C DG++  A +L   ME +   P+   FN LM G  R  +  K V LL RM +  + PD  + ++++D L +
Sbjct:  296 GCQPSTRTYTVLIKALCDRGLIDKAFNLFDEMIPRGCKPNVHTYTVLIDGLCRDGKIEEANGVCRKMVKDRIFPSVITYNALINGYCKDGRVVPAFELLTVMEKRACKPNVRTFNELMEGLCRVGKPYKAVHLLKRMLDNGLSPDIVSYNVLIDGLCR 453          

HSP 2 Score: 82.0333 bits (201), Expect = 4.690e-15
Identity = 49/158 (31.01%), Postives = 81/158 (51.27%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   +   Y   IDGLC++G I EA  + R +   +    + +Y+ LI+G CK GR+  A+EL   + +     +V T+N ++  LC  GK  KA  L   M   G++PD V++N L+ G  R    +   +LL  M+  ++ PD  T + +++   K
Sbjct:  331 GCKPNVHTYTVLIDGLCRDGKIEEANGVCRKMVKDRIFPSVITYNALINGYCKDGRVVPAFELLTVMEKRACKPNVRTFNELMEGLCRVGKPYKAVHLLKRMLDNGLSPDIVSYNVLIDGLCREGHMNTAYKLLSSMNCFDIEPDCLTFTAIINAFCK 488          

HSP 3 Score: 81.6481 bits (200), Expect = 6.125e-15
Identity = 42/150 (28.00%), Postives = 76/150 (50.67%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            Y   I+G CK+G +V A EL   +    C+ ++R+++ L++GLC+ G+   A  L   +    L  D+V+YN++I  LC +G M+ A+ L   M    + PDC+ F  ++    +  +       L  M  + +  D  T + ++D + K
Sbjct:  374 YNALINGYCKDGRVVPAFELLTVMEKRACKPNVRTFNELMEGLCRVGKPYKAVHLLKRMLDNGLSPDIVSYNVLIDGLCREGHMNTAYKLLSSMNCFDIEPDCLTFTAIINAFCKQGKADVASAFLGLMLRKGISLDEVTGTTLIDGVCK 523          

HSP 4 Score: 75.0998 bits (183), Expect = 5.733e-13
Identity = 47/157 (29.94%), Postives = 81/157 (51.59%), Query Frame = 1
Query:   22 AADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSL-PRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            A ++ +Y   I GLC+ G + EA  L   +    C+   R+Y+ LI  LC  G +  A+ LF  + PRG    +V TY ++I  LC DGK+++A+ +   M    + P  + +N L+ G  ++       ELL  M++R   P+  T + +++ L +
Sbjct:  263 APNSVSYSILIHGLCEVGRLEEAFGLKDQMGEKGCQPSTRTYTVLIKALCDRGLIDKAFNLFDEMIPRGCK-PNVHTYTVLIDGLCRDGKIEEANGVCRKMVKDRIFPSVITYNALINGYCKDGRVVPAFELLTVMEKRACKPNVRTFNELMEGLCR 418          

HSP 5 Score: 75.0998 bits (183), Expect = 5.733e-13
Identity = 46/152 (30.26%), Postives = 81/152 (53.29%), Query Frame = 1
Query:   43 RTF---IDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            RTF   ++GLC+ G   +A+ L + +       DI SY+ LIDGLC+ G +  A++L  S+    +  D +T+  +I+A C  GK D A      M  KG++ D V   TL+ G  +  +T   + +L  + +  ++    +L++++D+L K
Sbjct:  407 RTFNELMEGLCRVGKPYKAVHLLKRMLDNGLSPDIVSYNVLIDGLCREGHMNTAYKLLSSMNCFDIEPDCLTFTAIINAFCKQGKADVASAFLGLMLRKGISLDEVTGTTLIDGVCKVGKTRDALFILETLVKMRILTTPHSLNVILDMLSK 558          

HSP 6 Score: 72.4034 bits (176), Expect = 3.716e-12
Identity = 48/154 (31.17%), Postives = 80/154 (51.95%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSY--SCLIDGLCKSGRLKIAWELFHSLPRGVLIA-DVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            YRT ++ LCKNGY  EA E+F + +ILK    + S+  + L+ G C+   L+ A ++F  + + V  A + V+Y+I+IH LC  G++++A  L   M  KG  P    +  L+          K   L   M  R   P+  T ++++D L ++
Sbjct:  198 YRTIVNALCKNGY-TEAAEMFMS-KILKIGFVLDSHIGTSLLLGFCRGLNLRDALKVFDVMSKEVTCAPNSVSYSILIHGLCEVGRLEEAFGLKDQMGEKGCQPSTRTYTVLIKALCDRGLIDKAFNLFDEMIPRGCKPNVHTYTVLIDGLCRD 349          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR28_ARATH (Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.470e-18
Identity = 46/154 (29.87%), Postives = 85/154 (55.19%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G   D   Y T +  LCK+G + +A+E+   L    C   + +Y+ +IDGL K+G+   A +L   +    L  D +TY+ ++  L  +GK+D+A   F + E  G+ P+ V FN++MLG  ++ +T + ++ L  M  R   P+ ++ +I+++
Sbjct:  409 GCYPDIVTYNTMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGLSREGKVDEAIKFFHEFERMGIRPNAVTFNSIMLGLCKSRQTDRAIDFLVFMINRGCKPNETSYTILIE 562          

HSP 2 Score: 88.1965 bits (217), Expect = 6.544e-17
Identity = 45/155 (29.03%), Postives = 82/155 (52.90%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            R G +     +   I+ LC+ G +  A+++   +    C+ +  SY+ L+ G CK  ++  A E    +       D+VTYN M+ ALC DGK++ A ++   + +KG +P  + +NT++ G  +  +T K ++LL  M  +++ PD  T S +V
Sbjct:  337 RKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPQHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLV 491          

HSP 3 Score: 86.6557 bits (213), Expect = 1.904e-16
Identity = 44/162 (27.16%), Postives = 82/162 (50.62%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            R  G   D   Y   ++G+CK G + EA++    +    C+ ++ +++ ++  +C +GR   A +L   + R      VVT+NI+I+ LC  G + +A D+   M   G  P+ +++N L+ G  +  +  + +E L RM  R   PD  T + ++  L K+
Sbjct:  266 RDRGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPQHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKD 427          

HSP 4 Score: 83.5741 bits (205), Expect = 1.612e-15
Identity = 40/142 (28.17%), Postives = 75/142 (52.82%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDA 453
            D   Y   I+  C++  +  A++L   +R   C  D+ +Y+ L++G+CK GRL  A +  + +P      +V+T+NI++ ++C+ G+   A  L  DM  KG +P  V FN L+    R     + +++L +M +    P++
Sbjct:  238 DVITYTILIEATCRDSGVGHAMKLLDEMRDRGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPQHGCQPNS 379          

HSP 5 Score: 81.6481 bits (200), Expect = 6.125e-15
Identity = 43/161 (26.71%), Postives = 81/161 (50.31%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +HG   ++ +Y   + G CK   +  A+E    +    C  DI +Y+ ++  LCK G+++ A E+ + L        ++TYN +I  L   GK  KA  L  +M AK + PD + +++L+ G  R  +  + ++  H  +   + P+A T + ++  L K+
Sbjct:  372 QHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGLSREGKVDEAIKFFHEFERMGIRPNAVTFNSIMLGLCKS 532          

HSP 6 Score: 78.5666 bits (192), Expect = 5.185e-14
Identity = 40/160 (25.00%), Postives = 77/160 (48.12%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            R  V+ D   Y T +  LC +G + +A+E+   +    C  D+ +Y+ LI+  C+   +  A +L   +       DVVTYN++++ +C +G++D+A     DM + G  P+ +  N ++             +LL  M  +   P   T +I+++ L +
Sbjct:  197 RMSVSPDVVTYNTILRSLCDSGKLKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSGVGHAMKLLDEMRDRGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCR 356          

HSP 7 Score: 75.0998 bits (183), Expect = 5.733e-13
Identity = 45/159 (28.30%), Postives = 78/159 (49.06%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            HG   D     T I G C+ G   +A ++   L       D+ +Y+ +I G CK+G +  A  +   L R  +  DVVTYN ++ +LC  GK+ +A ++   M  +   PD + +  L+    R++     ++LL  M +R   PD  T +++V+ + K
Sbjct:  131 HGNVPDIIPCTTLIRGFCRLGKTRKAAKILEILEGSGAVPDVITYNVMISGYCKAGEINNALSV---LDRMSVSPDVVTYNTILRSLCDSGKLKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSGVGHAMKLLDEMRDRGCTPDVVTYNVLVNGICK 286          

HSP 8 Score: 68.5514 bits (166), Expect = 5.366e-11
Identity = 39/139 (28.06%), Postives = 71/139 (51.08%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDAS 456
            Y T IDGL K G   +A++L   +R    + D  +YS L+ GL + G++  A + FH   R  +  + VT+N ++  LC   + D+A D  + M  +G  P+  ++  L+ G        + +ELL+ +  + ++  +S
Sbjct:  452 YNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGLSREGKVDEAIKFFHEFERMGIRPNAVTFNSIMLGLCKSRQTDRAIDFLVFMINRGCKPNETSYTILIEGLAYEGMAKEALELLNELCNKGLMKKSS 590          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR27_ARATH (Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.532e-18
Identity = 53/153 (34.64%), Postives = 81/153 (52.94%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            GV  +   Y   I+G CKN  + EAL++F +++        R Y+ LID  CK G++   + L   + R  ++ DV TYN +I  LC +G ++ A  LF  + +KG+ PD V F+ LM G  R  E+ K   LL  M +  + P   T +IV+
Sbjct:  361 GVQPNLITYNALINGFCKNDMLKEALDMFGSVKGQGAVPTTRMYNMLIDAYCKLGKIDDGFALKEEMEREGIVPDVGTYNCLIAGLCRNGNIEAAKKLFDQLTSKGL-PDLVTFHILMEGYCRKGESRKAAMLLKEMSKMGLKPRHLTYNIVM 512          

HSP 2 Score: 79.7221 bits (195), Expect = 2.328e-14
Identity = 44/147 (29.93%), Postives = 77/147 (52.38%), Query Frame = 1
Query:   37 AYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            +Y + I+GLC  G I EA+ +   +     + ++ +Y+ LI+G CK+  LK A ++F S+     +     YN++I A C  GK+D    L  +ME +G+ PD   +N L+ G  RN       +L  ++  +  +PD  T  I+++
Sbjct:  333 SYNSLINGLCNGGKISEAISMRDKMVSAGVQPNLITYNALINGFCKNDMLKEALDMFGSVKGQGAVPTTRMYNMLIDAYCKLGKIDDGFALKEEMEREGIVPDVGTYNCLIAGLCRNGNIEAAKKLFDQLTSKG-LPDLVTFHILME 478          

HSP 3 Score: 73.9442 bits (180), Expect = 1.277e-12
Identity = 39/176 (22.16%), Postives = 89/176 (50.57%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCK---SGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKS 528
            R  +  + + +   I+ LCK G + +A ++   +++  C  ++ SY+ LIDG CK   +G++  A  +   +    +  ++ T+NI+I     D  +  +  +F +M  + V P+ +++N+L+ G     + S+ + +  +M    V P+  T + +++   KN++   ++  F S
Sbjct:  216 RRKIQPNVFTFNVVINALCKTGKMNKARDVMEDMKVYGCSPNVVSYNTLIDGYCKLGGNGKMYKADAVLKEMVENDVSPNLTTFNILIDGFWKDDNLPGSMKVFKEMLDQDVKPNVISYNSLINGLCNGGKISEAISMRDKMVSAGVQPNLITYNALINGFCKNDMLKEALDMFGS 391          

HSP 4 Score: 69.707 bits (169), Expect = 2.409e-11
Identity = 50/174 (28.74%), Postives = 84/174 (48.28%), Query Frame = 1
Query:   55 DGLCKNGYIVEAL--------------ELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIR---NNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            D +C N  I + L              E F+       +L   S   L+  L K  R      ++  + R  +  +V T+N++I+ALC  GKM+KA D+  DM+  G +P+ V++NTL+ G  +   N +  K   +L  M E +V P+ +T +I++D   K++    S+  FK
Sbjct:  147 DNVCVNSIIADMLVLAYANNSRFELGFEAFKRSGYYGYKLSALSCKPLMIALLKENRSADVEYVYKEMIRRKIQPNVFTFNVVINALCKTGKMNKARDVMEDMKVYGCSPNVVSYNTLIDGYCKLGGNGKMYKADAVLKEMVENDVSPNLTTFNILIDGFWKDDNLPGSMKVFK 320          

HSP 5 Score: 68.5514 bits (166), Expect = 5.366e-11
Identity = 45/160 (28.12%), Postives = 79/160 (49.38%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDME-AKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLV 486
            R G+  D   Y   I GLC+NG I  A +LF  L   K   D+ ++  L++G C+ G  + A  L   + +  L    +TYNI++   C +G +  A ++   ME  + +  +  ++N L+ G  +  +      LL+ M E+ ++P+  T  IV + +V
Sbjct:  429 REGIVPDVGTYNCLIAGLCRNGNIEAAKKLFDQLTS-KGLPDLVTFHILMEGYCRKGESRKAAMLLKEMSKMGLKPRHLTYNIVMKGYCKEGNLKAATNMRTQMEKERRLRMNVASYNVLLQGYSQKGKLEDANMLLNEMLEKGLVPNRITYEIVKEEMV 587          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP281_ARATH (Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.532e-18
Identity = 50/177 (28.25%), Postives = 92/177 (51.98%), Query Frame = 1
Query:    4 TRRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLV---KNEISLNSIPQFK 525
            + + G   D + + T ++GLCK G++  A+E+   +     + D+ +Y+ +I GLCK G +K A E+   +       + VTYN +I  LC + ++++A +L   + +KG+ PD   FN+L+ G          +EL   M  +   PD  T ++++D L    K + +LN + Q +
Sbjct:  286 SNQDGFFPDQYTFNTLVNGLCKAGHVKHAIEIMDVMLQEGYDPDVYTYNSVISGLCKLGEVKEAVEVLDQMITRDCSPNTVTYNTLISTLCKENQVEEATELARVLTSKGILPDVCTFNSLIQGLCLTRNHRVAMELFEEMRSKGCEPDEFTYNMLIDSLCSKGKLDEALNMLKQME 462          

HSP 2 Score: 92.0485 bits (227), Expect = 4.532e-18
Identity = 51/155 (32.90%), Postives = 83/155 (53.55%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +T  Y T I  LCK   + EA EL R L       D+ +++ LI GLC +   ++A ELF  +       D  TYN++I +LC+ GK+D+A ++   ME  G A   + +NTL+ G  + N+T +  E+   M+   V  ++ T + ++D L K+
Sbjct:  364 NTVTYNTLISTLCKENQVEEATELARVLTSKGILPDVCTFNSLIQGLCLTRNHRVAMELFEEMRSKGCEPDEFTYNMLIDSLCSKGKLDEALNMLKQMELSGCARSVITYNTLIDGFCKANKTREAEEIFDEMEVHGVSRNSVTYNTLIDGLCKS 518          

HSP 3 Score: 87.0409 bits (214), Expect = 1.458e-16
Identity = 46/161 (28.57%), Postives = 76/161 (47.20%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            R  G   D + Y   ID LC  G + EAL + + + +  C   + +Y+ LIDG CK+ + + A E+F  +    +  + VTYN +I  LC   +++ A  L   M  +G  PD   +N+L+    R  +  K  +++  M      PD  T   ++  L K
Sbjct:  427 RSKGCEPDEFTYNMLIDSLCSKGKLDEALNMLKQMELSGCARSVITYNTLIDGFCKANKTREAEEIFDEMEVHGVSRNSVTYNTLIDGLCKSRRVEDAAQLMDQMIMEGQKPDKYTYNSLLTHFCRGGDIKKAADIVQAMTSNGCEPDIVTYGTLISGLCK 587          

HSP 4 Score: 83.9593 bits (206), Expect = 1.234e-15
Identity = 46/148 (31.08%), Postives = 71/148 (47.97%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDAST 459
            G+  D   + + I GLC       A+ELF  +R   CE D  +Y+ LID LC  G+L  A  +   +        V+TYN +I   C   K  +A ++F +ME  GV+ + V +NTL+ G  ++       +L+ +M      PD  T
Sbjct:  395 GILPDVCTFNSLIQGLCLTRNHRVAMELFEEMRSKGCEPDEFTYNMLIDSLCSKGKLDEALNMLKQMELSGCARSVITYNTLIDGFCKANKTREAEEIFDEMEVHGVSRNSVTYNTLIDGLCKSRRVEDAAQLMDQMIMEGQKPDKYT 542          

HSP 5 Score: 81.6481 bits (200), Expect = 6.125e-15
Identity = 46/154 (29.87%), Postives = 82/154 (53.25%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERN-VIPDASTLSIV 471
            HGV+ ++  Y T IDGLCK+  + +A +L   + +   + D  +Y+ L+   C+ G +K A ++  ++       D+VTY  +I  LC  G+++ A  L   ++ KG+     A+N ++ G  R  +T++ + L   M E+N   PDA +  IV
Sbjct:  499 HGVSRNSVTYNTLIDGLCKSRRVEDAAQLMDQMIMEGQKPDKYTYNSLLTHFCRGGDIKKAADIVQAMTSNGCEPDIVTYGTLISGLCKAGRVEVASKLLRSIQMKGINLTPHAYNPVIQGLFRKRKTTEAINLFREMLEQNEAPPDAVSYRIV 652          

HSP 6 Score: 75.485 bits (184), Expect = 4.390e-13
Identity = 48/170 (28.24%), Postives = 76/170 (44.71%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            G A     Y T IDG CK     EA E+F  + +     +  +Y+ LIDGLCKS R++ A +L   +       D  TYN ++   C  G + KA D+   M + G  PD V + TL+ G  +        +LL  +  + +       + V+  L +   +  +I  F+
Sbjct:  465 GCARSVITYNTLIDGFCKANKTREAEEIFDEMEVHGVSRNSVTYNTLIDGLCKSRRVEDAAQLMDQMIMEGQKPDKYTYNSLLTHFCRGGDIKKAADIVQAMTSNGCEPDIVTYGTLISGLCKAGRVEVASKLLRSIQMKGINLTPHAYNPVIQGLFRKRKTTEAINLFR 634          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR92_ARATH (Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 7.731e-18
Identity = 49/155 (31.61%), Postives = 82/155 (52.90%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            R  +  D   Y + I+GLC +  I EA ++F  +    C  D+ SY+ LI+G CK+ R++   +LF  + +  L+++ VTYN +I      G +DKA + F  M+  G++PD   +N L+ G   N E  K + +   M +R +  D  T + V+
Sbjct:  288 RMSIDPDIVTYSSLINGLCLHDRIDEANQMFDLMVSKGCLADVVSYNTLINGFCKAKRVEDGMKLFREMSQRGLVSNTVTYNTLIQGFFQAGDVDKAQEFFSQMDFFGISPDIWTYNILLGGLCDNGELEKALVIFEDMQKREMDLDIVTYTTVI 442          

HSP 2 Score: 90.8929 bits (224), Expect = 1.010e-17
Identity = 49/151 (32.45%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            Y   +D   KNG ++EA ELF  +  +  + DI +YS LI+GLC   R+  A ++F  +     +ADVV+YN +I+  C   +++    LF +M  +G+  + V +NTL+ G  +  +  K  E   +MD   + PD  T +I++  L  N
Sbjct:  263 YSALLDAFVKNGKVLEAKELFEEMVRMSIDPDIVTYSSLINGLCLHDRIDEANQMFDLMVSKGCLADVVSYNTLINGFCKAKRVEDGMKLFREMSQRGLVSNTVTYNTLIQGFFQAGDVDKAQEFFSQMDFFGISPDIWTYNILLGGLCDN 413          

HSP 3 Score: 88.5817 bits (218), Expect = 5.011e-17
Identity = 46/152 (30.26%), Postives = 79/152 (51.97%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLS 465
            + G+ ++T  Y T I G  + G + +A E F  +       DI +Y+ L+ GLC +G L+ A  +F  + +  +  D+VTY  +I  +C  GK+++A  LF  +  KG+ PD V + T+M G        +V  L  +M +  ++ +  TLS
Sbjct:  358 QRGLVSNTVTYNTLIQGFFQAGDVDKAQEFFSQMDFFGISPDIWTYNILLGGLCDNGELEKALVIFEDMQKREMDLDIVTYTTVIRGMCKTGKVEEAWSLFCSLSLKGLKPDIVTYTTMMSGLCTKGLLHEVEALYTKMKQEGLMKNDCTLS 509          

HSP 4 Score: 82.4185 bits (202), Expect = 3.591e-15
Identity = 43/155 (27.74%), Postives = 82/155 (52.90%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            R G+  +   Y   ++GLC +    +A  L   +   K   ++ +YS L+D   K+G++  A ELF  + R  +  D+VTY+ +I+ LC   ++D+A+ +F  M +KG   D V++NTL+ G  +       ++L   M +R ++ +  T + ++
Sbjct:  218 RKGIRPNVVTYTALVNGLCNSSRWSDAARLLSDMIKKKITPNVITYSALLDAFVKNGKVLEAKELFEEMVRMSIDPDIVTYSSLINGLCLHDRIDEANQMFDLMVSKGCLADVVSYNTLINGFCKAKRVEDGMKLFREMSQRGLVSNTVTYNTLI 372          

HSP 5 Score: 77.0258 bits (188), Expect = 1.509e-13
Identity = 39/154 (25.32%), Postives = 78/154 (50.65%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G   D     + ++G C+   + +A+ L   +  +  + DI +Y+ +ID LCK+ R+  A++ F  + R  +  +VVTY  +++ LC   +   A  L  DM  K + P+ + ++ L+   ++N +  +  EL   M   ++ PD  T S +++
Sbjct:  150 GYEPDRVTIGSLVNGFCRRNRVSDAVSLVDKMVEIGYKPDIVAYNAIIDSLCKTKRVNDAFDFFKEIERKGIRPNVVTYTALVNGLCNSSRWSDAARLLSDMIKKKITPNVITYSALLDAFVKNGKVLEAKELFEEMVRMSIDPDIVTYSSLIN 303          

HSP 6 Score: 74.3294 bits (181), Expect = 9.779e-13
Identity = 43/159 (27.04%), Postives = 76/159 (47.80%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            G+  D + +   I+  C    +  AL +   +  L  E D  +   L++G C+  R+  A  L   +       D+V YN +I +LC   +++ A D F ++E KG+ P+ V +  L+ G   ++  S    LL  M ++ + P+  T S ++D  VKN
Sbjct:  115 GIRNDLYTFNIVINCFCCCFQVSLALSILGKMLKLGYEPDRVTIGSLVNGFCRRNRVSDAVSLVDKMVEIGYKPDIVAYNAIIDSLCKTKRVNDAFDFFKEIERKGIRPNVVTYTALVNGLCNSSRWSDAARLLSDMIKKKITPNVITYSALLDAFVKN 273          

HSP 7 Score: 74.3294 bits (181), Expect = 9.779e-13
Identity = 41/153 (26.80%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G  AD  +Y T I+G CK   + + ++LFR +       +  +Y+ LI G  ++G +  A E F  +    +  D+ TYNI++  LC +G+++KA  +F DM+ + +  D V + T++ G  +  +  +   L   +  + + PD  T + ++
Sbjct:  325 GCLADVVSYNTLINGFCKAKRVEDGMKLFREMSQRGLVSNTVTYNTLIQGFFQAGDVDKAQEFFSQMDFFGISPDIWTYNILLGGLCDNGELEKALVIFEDMQKREMDLDIVTYTTVIRGMCKTGKVEEAWSLFCSLSLKGLKPDIVTYTTMM 477          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP102_ARATH (Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 7.731e-18
Identity = 49/150 (32.67%), Postives = 78/150 (52.00%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDAST 459
            + G+  +T  Y T I G  +      A  +F+ +       +I +Y+ L+DGLCK+G+L+ A  +F  L R  +   + TYNIMI  +C  GK++   DLF  +  KGV PD + +NT++ G  R     +   L  +M E   +PD+ T
Sbjct:  428 QRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSDGVHPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQRSKMEPTIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPDVIIYNTMISGFCRKGLKEEADALFRKMREDGPLPDSGT 577          

HSP 2 Score: 85.1149 bits (209), Expect = 5.540e-16
Identity = 51/159 (32.08%), Postives = 86/159 (54.09%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNET-SKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   DT  + T I GL  +    EA+ L   +    C+ ++ +Y  +++GLCK G + +A+ L + +    + A+VV Y+ +I +LC     D A +LF +ME KGV P+ + +++L + C+ N E  S    LL  M ER + P+  T + ++D  VK
Sbjct:  185 GYRPDTITFTTLIHGLFLHNKASEAVALVDRMVQRGCQPNLVTYGVVVNGLCKRGDIDLAFNLLNKMEAAKIEANVVIYSTVIDSLCKYRHEDDALNLFTEMENKGVRPNVITYSSL-ISCLCNYERWSDASRLLSDMIERKINPNVVTFNALIDAFVK 342          

HSP 3 Score: 81.6481 bits (200), Expect = 6.125e-15
Identity = 42/160 (26.25%), Postives = 80/160 (50.00%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +  +  D + Y + I+G C +  + EA  +F  +    C  ++ +Y+ LI+G CK+ R+    ELF  + +  L+ + VTY  +IH        D A  +F  M + GV P+ + +NTL+ G  +N +  K + +   +    + P   T +I+++ + K
Sbjct:  358 KRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLINGFCKAKRIDEGVELFREMSQRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSDGVHPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQRSKMEPTIYTYNIMIEGMCK 517          

HSP 4 Score: 75.0998 bits (183), Expect = 5.733e-13
Identity = 44/151 (29.14%), Postives = 75/151 (49.67%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +   ID   K G +VEA +L+  +     + DI +YS LI+G C   RL  A  +F  +       +VVTYN +I+  C   ++D+  +LF +M  +G+  + V + TL+ G  +  +      +  +M    V P+  T + ++D L KN
Sbjct:  333 FNALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLINGFCKAKRIDEGVELFREMSQRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSDGVHPNIMTYNTLLDGLCKN 483          

HSP 5 Score: 72.7886 bits (177), Expect = 2.845e-12
Identity = 44/156 (28.21%), Postives = 74/156 (47.44%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + G   +   Y   ++GLCK G I  A  L   +   K E ++  YS +ID LCK      A  LF  +    +  +V+TY+ +I  LC   +   A  L  DM  + + P+ V FN L+   ++  +  +  +L   M +R++ PD  T S +++
Sbjct:  218 QRGCQPNLVTYGVVVNGLCKRGDIDLAFNLLNKMEAAKIEANVVIYSTVIDSLCKYRHEDDALNLFTEMENKGVRPNVITYSSLISCLCNYERWSDASRLLSDMIERKINPNVVTFNALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLIN 373          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR93_ARATH (Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.010e-17
Identity = 49/146 (33.56%), Postives = 79/146 (54.11%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIP 447
            + G+  DT  Y T I G  + G    A E+F  +       +IR+YS L+ GLC + R++ A  LF ++ +  +  D+ TYNI+IH +C  G ++ A DLF  +  KG+ PD V++ T++ G  R  +  K   L  +M E  ++P
Sbjct:  342 QRGLVGDTITYNTIIQGYFQAGRPDAAQEIFSRM---DSRPNIRTYSILLYGLCMNWRVEKALVLFENMQKSEIELDITTYNIVIHGMCKIGNVEDAWDLFRSLSCKGLKPDVVSYTTMISGFCRKRQWDKSDLLYRKMQEDGLLP 484          

HSP 2 Score: 88.5817 bits (218), Expect = 5.011e-17
Identity = 46/155 (29.68%), Postives = 81/155 (52.26%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            R GV AD   Y + + GLC +G   +A  L R + +     ++ +++ +ID   K G+   A +L+  + R  +  DV TYN +I+ LC  G++D+A  +   M  KG  PD V +NTL+ G  ++    +  +L   M +R ++ D  T + ++
Sbjct:  202 RDGVRADAVTYNSLVAGLCCSGRWSDAARLMRDMVMRDIVPNVITFTAVIDVFVKEGKFSEAMKLYEEMTRRCVDPDVFTYNSLINGLCMHGRVDEAKQMLDLMVTKGCLPDVVTYNTLINGFCKSKRVDEGTKLFREMAQRGLVGDTITYNTII 356          

HSP 3 Score: 82.8037 bits (203), Expect = 2.750e-15
Identity = 46/160 (28.75%), Postives = 82/160 (51.25%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            R  V  D + Y + I+GLC +G + EA ++   +    C  D+ +Y+ LI+G CKS R+    +LF  + +  L+ D +TYN +I      G+ D A ++F  M+++   P+   ++ L+ G   N    K + L   M +  +  D +T +IV+  + K
Sbjct:  272 RRCVDPDVFTYNSLINGLCMHGRVDEAKQMLDLMVTKGCLPDVVTYNTLINGFCKSKRVDEGTKLFREMAQRGLVGDTITYNTIIQGYFQAGRPDAAQEIFSRMDSR---PNIRTYSILLYGLCMNWRVEKALVLFENMQKSEIELDITTYNIVIHGMCK 428          

HSP 4 Score: 82.4185 bits (202), Expect = 3.591e-15
Identity = 43/156 (27.56%), Postives = 78/156 (50.00%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + G   D     + I+G C+   + +A++L   +  +    D+  Y+ +IDG CK G +  A ELF  + R  + AD VTYN ++  LC  G+   A  L  DM  + + P+ + F  ++   ++  + S+ ++L   M  R V PD  T + +++
Sbjct:  132 KFGYEPDVVTVSSLINGFCQGNRVFDAIDLVSKMEEMGFRPDVVIYNTIIDGSCKIGLVNDAVELFDRMERDGVRADAVTYNSLVAGLCCSGRWSDAARLMRDMVMRDIVPNVITFTAVIDVFVKEGKFSEAMKLYEEMTRRCVDPDVFTYNSLIN 287          

HSP 5 Score: 82.0333 bits (201), Expect = 4.690e-15
Identity = 49/158 (31.01%), Postives = 79/158 (50.00%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G+  D ++Y   I+ LC+    V AL +   +     E D+ + S LI+G C+  R+  A +L   +       DVV YN +I   C  G ++ A +LF  ME  GV  D V +N+L+ G   +   S    L+  M  R+++P+  T + V+D+ VK
Sbjct:   99 GIGHDLYSYNIVINCLCRCSRFVIALSVVGKMMKFGYEPDVVTVSSLINGFCQGNRVFDAIDLVSKMEEMGFRPDVVIYNTIIDGSCKIGLVNDAVELFDRMERDGVRADAVTYNSLVAGLCCSGRWSDAARLMRDMVMRDIVPNVITFTAVIDVFVK 256          

HSP 6 Score: 79.337 bits (194), Expect = 3.040e-14
Identity = 45/151 (29.80%), Postives = 77/151 (50.99%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +   ID   K G   EA++L+  +     + D+ +Y+ LI+GLC  GR+  A ++   +     + DVVTYN +I+  C   ++D+   LF +M  +G+  D + +NT++ G  +        E+  RMD R   P+  T SI++  L  N
Sbjct:  247 FTAVIDVFVKEGKFSEAMKLYEEMTRRCVDPDVFTYNSLINGLCMHGRVDEAKQMLDLMVTKGCLPDVVTYNTLINGFCKSKRVDEGTKLFREMAQRGLVGDTITYNTIIQGYFQAGRPDAAQEIFSRMDSR---PNIRTYSILLYGLCMN 394          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP418_ARATH (Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.319e-17
Identity = 51/155 (32.90%), Postives = 82/155 (52.90%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            + G   D++ Y T I GLC+ G I EA +LF  +    C   + +Y+ LI+GLC S  +  A      +    +  +V TY+ ++  LC DG+  +A +LF  M A+G  P+ V + TL+ G  +  +  + VELL RM+ + + PDA     V+
Sbjct:  185 KRGCDPDSYTYGTLISGLCRFGRIDEAKKLFTEMVEKDCAPTVVTYTSLINGLCGSKNVDEAMRYLEEMKSKGIEPNVFTYSSLMDGLCKDGRSLQAMELFEMMMARGCRPNMVTYTTLITGLCKEQKIQEAVELLDRMNLQGLKPDAGLYGKVI 339          

HSP 2 Score: 78.1814 bits (191), Expect = 6.772e-14
Identity = 47/164 (28.66%), Postives = 82/164 (50.00%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEA-LELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            R  G+     +    I  LC+N   V+A L++F  +    C+ D  +Y  LI GLC+ GR+  A +LF  +        VVTY  +I+ LC    +D+A     +M++KG+ P+   +++LM G  ++  + + +EL   M  R   P+  T + ++  L K +
Sbjct:  148 REIGLPPTVASLNVLIKALCRNDGTVDAGLKIFLEMPKRGCDPDSYTYGTLISGLCRFGRIDEAKKLFTEMVEKDCAPTVVTYTSLINGLCGSKNVDEAMRYLEEMKSKGIEPNVFTYSSLMDGLCKDGRSLQAMELFEMMMARGCRPNMVTYTTLITGLCKEQ 311          

HSP 3 Score: 69.707 bits (169), Expect = 2.409e-11
Identity = 43/164 (26.22%), Postives = 80/164 (48.78%), Query Frame = 1
Query:   37 AYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKS-GRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            AY T +  L +   +  A + ++ +R +     + S + LI  LC++ G +    ++F  +P+     D  TY  +I  LC  G++D+A  LF +M  K  AP  V + +L+ G   +    + +  L  M  + + P+  T S ++D L K+  SL ++  F+
Sbjct:  123 AYVTVLAILVEENQLNLAFKFYKNMREIGLPPTVASLNVLIKALCRNDGTVDAGLKIFLEMPKRGCDPDSYTYGTLISGLCRFGRIDEAKKLFTEMVEKDCAPTVVTYTSLINGLCGSKNVDEAMRYLEEMKSKGIEPNVFTYSSLMDGLCKDGRSLQAMELFE 286          

HSP 4 Score: 69.707 bits (169), Expect = 2.409e-11
Identity = 42/145 (28.97%), Postives = 72/145 (49.66%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            Y + I+GLC +  + EA+     ++    E ++ +YS L+DGLCK GR   A ELF  +       ++VTY  +I  LC + K+ +A +L   M  +G+ PD   +  ++ G    ++  +    L  M    + P+  T +I V
Sbjct:  230 YTSLINGLCGSKNVDEAMRYLEEMKSKGIEPNVFTYSSLMDGLCKDGRSLQAMELFEMMMARGCRPNMVTYTTLITGLCKEQKIQEAVELLDRMNLQGLKPDAGLYGKVISGFCAISKFREAANFLDEMILGGITPNRLTWNIHV 374          

HSP 5 Score: 68.9366 bits (167), Expect = 4.109e-11
Identity = 45/164 (27.44%), Postives = 78/164 (47.56%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFN------TLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G+  + + Y + +DGLCK+G  ++A+ELF  +    C  ++ +Y+ LI GLCK  +++ A EL   +    L  D   Y  +I   CA  K  +A +   +M   G+ P+ + +N        ++  +  N  S+   L   M  R +  +  TL  +V  L K
Sbjct:  257 GIEPNVFTYSSLMDGLCKDGRSLQAMELFEMMMARGCRPNMVTYTTLITGLCKEQKIQEAVELLDRMNLQGLKPDAGLYGKVISGFCAISKFREAANFLDEMILGGITPNRLTWNIHVKTSNEVVRGLCANYPSRAFTLYLSMRSRGISVEVETLESLVKCLCK 420          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP106_ARATH (Pentatricopeptide repeat-containing protein At1g64582, mitochondrial OS=Arabidopsis thaliana GN=At1g64582 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.319e-17
Identity = 48/143 (33.57%), Postives = 75/143 (52.45%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVI 444
            G  AD + Y T I G C+ G +  AL++F  +   +   DI ++  L+ GLC +G ++ A   F  +        +V YNIMIH LC   K++KA +LF  +  +GV PD   +  ++LG  +N    +  EL+ RM E  +I
Sbjct:  346 GFNADIFTYNTLIHGYCQVGKLRVALDIFCWMVSRRVTPDIITHCILLHGLCVNGEIESALVKFDDMRESEKYIGIVAYNIMIHGLCKADKVEKAWELFCRLPVEGVKPDARTYTIMILGLCKNGPRREADELIRRMKEEGII 488          

HSP 2 Score: 87.0409 bits (214), Expect = 1.458e-16
Identity = 48/151 (31.79%), Postives = 82/151 (54.30%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            Y T I G CK   + E ++LF+ +       DI +Y+ LI G C+ G+L++A ++F  +    +  D++T+ I++H LC +G+++ A   F DM         VA+N ++ G  + ++  K  EL  R+    V PDA T +I++  L KN
Sbjct:  319 YNTLISGFCKFRMVDEGMKLFQRMSCEGFNADIFTYNTLIHGYCQVGKLRVALDIFCWMVSRRVTPDIITHCILLHGLCVNGEIESALVKFDDMRESEKYIGIVAYNIMIHGLCKADKVEKAWELFCRLPVEGVKPDARTYTIMILGLCKN 469          

HSP 3 Score: 81.6481 bits (200), Expect = 6.125e-15
Identity = 45/159 (28.30%), Postives = 82/159 (51.57%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +G++ D +++   I   C+   +  AL +   +  L  E  I ++  L+ G C   R+  A+ L   + +     +VV YN +I  LC +G+++ A +L  +ME KG+  D V +NTL+ G   +   S    +L  M +R++ PD  T + ++D+ VK
Sbjct:  100 YGISHDLYSFTILIHCFCRCSRLSFALSVLGKMMKLGYEPSIVTFGSLLHGFCLVNRIGDAFSLVILMVKSGYEPNVVVYNTLIDGLCKNGELNIALELLNEMEKKGLGADVVTYNTLLTGLCYSGRWSDAARMLRDMMKRSINPDVVTFTALIDVFVK 258          

HSP 4 Score: 78.9518 bits (193), Expect = 3.970e-14
Identity = 43/155 (27.74%), Postives = 74/155 (47.74%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            + G   +   Y T IDGLCKNG +  ALEL   +       D+ +Y+ L+ GLC SGR   A  +   + +  +  DVVT+  +I      G +D+A +L+ +M    V P+ V +N+++ G   +       +    M  +   P+  T + ++
Sbjct:  169 KSGYEPNVVVYNTLIDGLCKNGELNIALELLNEMEKKGLGADVVTYNTLLTGLCYSGRWSDAARMLRDMMKRSINPDVVTFTALIDVFVKQGNLDEAQELYKEMIQSSVDPNNVTYNSIINGLCMHGRLYDAKKTFDLMASKGCFPNVVTYNTLI 323          

HSP 5 Score: 77.7962 bits (190), Expect = 8.845e-14
Identity = 45/146 (30.82%), Postives = 74/146 (50.68%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + + + G C    I +A  L   +     E ++  Y+ LIDGLCK+G L IA EL + + +  L ADVVTYN ++  LC  G+   A  +  DM  + + PD V F  L+   ++     +  EL   M + +V P+  T + +++
Sbjct:  144 FGSLLHGFCLVNRIGDAFSLVILMVKSGYEPNVVVYNTLIDGLCKNGELNIALELLNEMEKKGLGADVVTYNTLLTGLCYSGRWSDAARMLRDMMKRSINPDVVTFTALIDVFVKQGNLDEAQELYKEMIQSSVDPNNVTYNSIIN 289          

HSP 6 Score: 75.8702 bits (185), Expect = 3.361e-13
Identity = 45/155 (29.03%), Postives = 76/155 (49.03%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            + G+ AD   Y T + GLC +G   +A  + R +       D+ +++ LID   K G L  A EL+  + +  +  + VTYN +I+ LC  G++  A   F  M +KG  P+ V +NTL+ G  +     + ++L  RM       D  T + ++
Sbjct:  204 KKGLGADVVTYNTLLTGLCYSGRWSDAARMLRDMMKRSINPDVVTFTALIDVFVKQGNLDEAQELYKEMIQSSVDPNNVTYNSIINGLCMHGRLYDAKKTFDLMASKGCFPNVVTYNTLISGFCKFRMVDEGMKLFQRMSCEGFNADIFTYNTLI 358          

HSP 7 Score: 69.3218 bits (168), Expect = 3.146e-11
Identity = 47/175 (26.86%), Postives = 80/175 (45.71%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKSQR 534
            +  +  D   +   ID   K G + EA EL++ +     + +  +Y+ +I+GLC  GRL  A + F  +       +VVTYN +I   C    +D+   LF  M  +G   D   +NTL+ G  +  +    +++   M  R V PD  T  I++  L  N    +++ +F   R
Sbjct:  239 KRSINPDVVTFTALIDVFVKQGNLDEAQELYKEMIQSSVDPNNVTYNSIINGLCMHGRLYDAKKTFDLMASKGCFPNVVTYNTLISGFCKFRMVDEGMKLFQRMSCEGFNADIFTYNTLIHGYCQVGKLRVALDIFCWMVSRRVTPDIITHCILLHGLCVNGEIESALVKFDDMR 413          
The following BLAST results are available for this feature:
BLAST of FC928858 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
PP306_ARATH1.193e-1828.75Pentatricopeptide repeat-containing protein At4g11... [more]
PP218_ARATH2.034e-1831.65Pentatricopeptide repeat-containing protein At3g07... [more]
PPR28_ARATH3.470e-1829.87Pentatricopeptide repeat-containing protein At1g09... [more]
PPR27_ARATH4.532e-1834.64Pentatricopeptide repeat-containing protein At1g09... [more]
PP281_ARATH4.532e-1828.25Pentatricopeptide repeat-containing protein At3g53... [more]
PPR92_ARATH7.731e-1831.61Pentatricopeptide repeat-containing protein At1g62... [more]
PP102_ARATH7.731e-1832.67Pentatricopeptide repeat-containing protein At1g63... [more]
PPR93_ARATH1.010e-1733.56Pentatricopeptide repeat-containing protein At1g62... [more]
PP418_ARATH1.319e-1732.90Pentatricopeptide repeat-containing protein At5g46... [more]
PP106_ARATH1.319e-1733.57Pentatricopeptide repeat-containing protein At1g64... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1CB01RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CB01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928858 ID=FC928858|Name=FC928858|organism=Citrus clementina|type=EST|length=866bp
GGCACGAGGCGTCATGGCGTGGCAGCTGATACCTGGGCATATAGAACCTT
TATTGATGGGCTCTGCAAGAATGGTTATATTGTAGAGGCACTTGAACTAT
TTCGTACTTTGAGAATTCTCAAGTGTGAACTTGATATTCGATCCTACAGC
TGCCTCATTGATGGATTATGTAAATCCGGCAGACTCAAAATTGCATGGGA
ACTATTTCATAGTTTGCCTCGTGGAGTCCTAATAGCAGATGTTGTAACAT
ATAACATCATGATCCATGCGCTTTGTGCTGATGGAAAAATGGACAAGGCA
CATGATTTGTTTCTTGATATGGAAGCAAAAGGTGTAGCACCCGATTGTGT
CGCATTTAACACGCTGATGCTAGGTTGCATCCGCAATAATGAGACATCAA
AAGTTGTTGAACTCCTTCACAGAATGGATGAGAGAAATGTGATACCAGAT
GCATCTACACTTTCAATTGTTGTGGACTTACTTGTAAAGAATGAAATTAG
CTTAAACTCCATTCCACAATTCAAGAGTCAAAGGTAAGTGAGTTTAATAT
TGATTTAGTCGCATGTTTCTTCTGCCTGAAAACCCGATCTGGAGGATCCC
ATTCTTATTAACACGTGTAAAGGAGTGTTGTCTAATGTTGGCATGTTCCT
AGGTTCTGTCCATGGATTCTGTTTGCAGACATGGCTAACTTCTTGTCCAA
CAGATAAGTTTTAAAGTCTTTCAACTTTATGTTGTAAAATAACATTTTCA
TTATTCAATTCATGAGTTTTCCTTCTGTATCACATACTTCTCATTAGCTG
GAAGCGCAAATTTTTTAGGCTTTTCCTGTATGGCCTCTTTTTCTGCTCTA
AATAAAATGGCATTTT
back to top