FC928858

Overview
NameFC928858
Unique NameFC928858
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length866
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9258 contig Ccv1_Contig9258:11..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP339_ARATH (Pentatricopeptide repeat-containing protein At4g26800 OS=Arabidopsis thaliana GN=At4g26800 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.782e-14
Identity = 44/159 (27.67%), Postives = 79/159 (49.69%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            G+  D       ID LCKN  +V ALE+ + ++      ++ +YS LI GLCKSGRL  A    H +    +  +V+T++ +I A    GK+ K   ++  M    + P+   +++L+ G   +N   + +++L  M  +   P+  T S + +   K+
Sbjct:  188 GIKRDVVVDTILIDTLCKNRLVVPALEVLKRMKDRGISPNVVTYSSLITGLCKSGRLADAERRLHEMDSKKINPNVITFSALIDAYAKRGKLSKVDSVYKMMIQMSIDPNVFTYSSLIYGLCMHNRVDEAIKMLDLMISKGCTPNVVTYSTLANGFFKS 346          

HSP 2 Score: 70.4774 bits (171), Expect = 1.412e-11
Identity = 41/150 (27.33%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLS 465
            G++ +   Y + I GLCK+G + +A      +   K   ++ ++S LID   K G+L     ++  + +  +  +V TY+ +I+ LC   ++D+A  +   M +KG  P+ V ++TL  G  +++     ++LL  M +R V   A+T+S
Sbjct:  223 GISPNVVTYSSLITGLCKSGRLADAERRLHEMDSKKINPNVITFSALIDAYAKRGKLSKVDSVYKMMIQMSIDPNVFTYSSLIYGLCMHNRVDEAIKMLDLMISKGCTPNVVTYSTLANGFFKSSRVDDGIKLLDDMPQRGVA--ANTVS 370          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP131_ARATH (Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana GN=At1g79080 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.782e-14
Identity = 43/141 (30.50%), Postives = 74/141 (52.48%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERN 438
            G+A + + Y   ++   K     EA++L   + +   E ++ SY+ L+ G CK GR   A  LF  LP     A+VV+YNI++  LC DG+ ++A+ L  +M+    AP  V +N L+     +  T + +++L  M + N
Sbjct:  206 GLAPNAFTYSFLLEAAYKERGTDEAVKLLDEIIVKGGEPNLVSYNVLLTGFCKEGRTDDAMALFRELPAKGFKANVVSYNILLRCLCCDGRWEEANSLLAEMDGGDRAPSVVTYNILINSLAFHGRTEQALQVLKEMSKGN 346          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP338_ARATH (Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.328e-14
Identity = 41/155 (26.45%), Postives = 81/155 (52.26%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            R G  A   +Y T I G C+ G +  AL+L   +     + ++ +++ LI G C++ +L+ A ++F  +    +  + VTYN +I+     G  + A   + DM   G+  D + +N L+ G  +  +T K  + +  +D+ N++P++ST S ++
Sbjct:  266 RLGFRATDVSYNTLIAGHCEKGLLSSALKLKNMMGKSGLQPNVVTFNTLIHGFCRAMKLQEASKVFGEMKAVNVAPNTVTYNTLINGYSQQGDHEMAFRFYEDMVCNGIQRDILTYNALIFGLCKQAKTRKAAQFVKELDKENLVPNSSTFSALI 420          

HSP 2 Score: 70.0922 bits (170), Expect = 1.844e-11
Identity = 39/163 (23.93%), Postives = 80/163 (49.08%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLG-CIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            + G+  +   + T I G C+   + EA ++F  ++ +    +  +Y+ LI+G  + G  ++A+  +  +    +  D++TYN +I  LC   K  KA     +++ + + P+   F+ L++G C+R N   +  EL   M      P+  T +++V    +NE
Sbjct:  301 KSGLQPNVVTFNTLIHGFCRAMKLQEASKVFGEMKAVNVAPNTVTYNTLINGYSQQGDHEMAFRFYEDMVCNGIQRDILTYNALIFGLCKQAKTRKAAQFVKELDKENLVPNSSTFSALIMGQCVRKN-ADRGFELYKSMIRSGCHPNEQTFNMLVSAFCRNE 462          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP282_ARATH (Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.328e-14
Identity = 43/151 (28.48%), Postives = 77/151 (50.99%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            Y + I G    G +V AL+L++ +       D+ +Y+ LIDGL K G L +A EL+  +    L+ D + Y ++++ L   G+  K   +F +M+   V P+ + +N ++ G  R     +   L   M ++ ++PD +T  I+V   V N
Sbjct:  692 YNSLISGFRNLGNMVAALDLYKKMLKDGLRCDLGTYTTLIDGLLKDGNLILASELYTEMQAVGLVPDEIIYTVIVNGLSKKGQFVKVVKMFEEMKKNNVTPNVLIYNAVIAGHYREGNLDEAFRLHDEMLDKGILPDGATFDILVSGQVGN 842          

HSP 2 Score: 77.411 bits (189), Expect = 1.155e-13
Identity = 47/189 (24.87%), Postives = 86/189 (45.50%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKS-----------------------------------GRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            +G++ +   Y + ++GLCKN  + +ALE+   ++    +LDI +Y  LIDG CK                                    G +  A +L+  + +  L  D+ TY  +I  L  DG +  A +L+ +M+A G+ PD + +  ++ G  +  +  KVV++   M + NV P+    + V+
Sbjct:  613 NGISPNVITYTSLMNGLCKNNRMDQALEMRDEMKNKGVKLDIPAYGALIDGFCKRSNMESASALFSELLEEGLNPSQPIYNSLISGFRNLGNMVAALDLYKKMLKDGLRCDLGTYTTLIDGLLKDGNLILASELYTEMQAVGLVPDEIIYTVIVNGLSKKGQFVKVVKMFEEMKKNNVTPNVLIYNAVI 801          

HSP 3 Score: 71.633 bits (174), Expect = 6.339e-12
Identity = 45/169 (26.63%), Postives = 85/169 (50.30%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELF-HSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSI 513
            + G + ++  +   I+   KNG + +ALE ++ + +L     +     +I G  K  + + A +LF  S   G  +A+V   N ++  LC  GK D+A +L   ME++G+ P+ V++N +MLG  R         +   + E+ + P+  T SI++D   +N    N++
Sbjct:  367 KEGPSPNSVTFSVLIEWFRKNGEMEKALEFYKKMEVLGLTPSVFHVHTIIQGWLKGQKHEEALKLFDESFETG--LANVFVCNTILSWLCKQGKTDEATELLSKMESRGIGPNVVSYNNVMLGHCRQKNMDLARIVFSNILEKGLKPNNYTYSILIDGCFRNHDEQNAL 533          

HSP 4 Score: 69.3218 bits (168), Expect = 3.146e-11
Identity = 38/135 (28.15%), Postives = 70/135 (51.85%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVEL 414
            + G+  D   Y T IDGL K+G ++ A EL+  ++ +    D   Y+ +++GL K G+     ++F  + +  +  +V+ YN +I     +G +D+A  L  +M  KG+ PD   F+ L+ G + N +  +   L
Sbjct:  717 KDGLRCDLGTYTTLIDGLLKDGNLILASELYTEMQAVGLVPDEIIYTVIVNGLSKKGQFVKVVKMFEEMKKNNVTPNVLIYNAVIAGHYREGNLDEAFRLHDEMLDKGILPDGATFDILVSGQVGNLQPVRAASL 851          

HSP 5 Score: 68.9366 bits (167), Expect = 4.109e-11
Identity = 41/155 (26.45%), Postives = 74/155 (47.74%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELF-HSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G+  + + Y   IDG  +N     ALE+   +     E++   Y  +I+GLCK G+   A EL  + +    L    ++YN +I     +G+MD A   + +M   G++P+ + + +LM G  +NN   + +E+   M  + V  D      ++D
Sbjct:  508 GLKPNNYTYSILIDGCFRNHDEQNALEVVNHMTSSNIEVNGVVYQTIINGLCKVGQTSKARELLANMIEEKRLCVSCMSYNSIIDGFFKEGEMDSAVAAYEEMCGNGISPNVITYTSLMNGLCKNNRMDQALEMRDEMKNKGVKLDIPAYGALID 662          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP123_ARATH (Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.328e-14
Identity = 51/160 (31.87%), Postives = 80/160 (50.00%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLML--GCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            R G   +T  Y   I    +  Y+ EA+ +F  ++   CE D  +Y  LID   K+G L IA +++  +    L  D  TY+++I+ L   G +  AH LF +M  +G  P+ V FN ++      RN ET+  ++L   M      PD  T SIV+++L
Sbjct:  387 RDGCKPNTVTYNRLIHSYGRANYLKEAMNVFNQMQEAGCEPDRVTYCTLIDIHAKAGFLDIAMDMYQRMQEAGLSPDTFTYSVIINCLGKAGHLPAAHRLFCEMVGQGCTPNLVTFNIMIALHAKARNYETA--LKLYRDMQNAGFQPDKVTYSIVMEVL 544          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR76_ARATH (Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.040e-14
Identity = 45/155 (29.03%), Postives = 82/155 (52.90%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIV 471
            ++ G + D + Y   I    + G + EA+ +F  L    C+ DI SY+ LI+ L K+G +  A   F  +    L  DVVTY+ ++       +++ A+ LF +M  KG  P+ V +N L+    +N  T++ V+L  +M ++ + PD+ T +++
Sbjct:  469 KKDGPSPDIFTYNILIASFGRVGEVDEAINIFEELERSDCKPDIISYNSLINCLGKNGDVDEAHVRFKEMQEKGLNPDVVTYSTLMECFGKTERVEMAYSLFEEMLVKGCQPNIVTYNILLDCLEKNGRTAEAVDLYSKMKQQGLTPDSITYTVL 623          

HSP 2 Score: 77.7962 bits (190), Expect = 8.845e-14
Identity = 49/173 (28.32%), Postives = 81/173 (46.82%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKSQR 534
            GV  DT  Y T    L K   I    +LF  ++      DI +Y+ LI    + G +  A  +F  L R     D+++YN +I+ L  +G +D+AH  F +M+ KG+ PD V ++TLM    +         L   M  +   P+  T +I++D L KN  +  ++  +   +
Sbjct:  437 GVVTDTMMYNTVFSALGKLKQISHIHDLFEKMKKDGPSPDIFTYNILIASFGRVGEVDEAINIFEELERSDCKPDIISYNSLINCLGKNGDVDEAHVRFKEMQEKGLNPDVVTYSTLMECFGKTERVEMAYSLFEEMLVKGCQPNIVTYNILLDCLEKNGRTAEAVDLYSKMK 609          

HSP 3 Score: 68.5514 bits (166), Expect = 5.366e-11
Identity = 40/170 (23.53%), Postives = 79/170 (46.47%), Query Frame = 1
Query:   13 HGVAADTWA---------YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            H +  D W+         Y + ++ LC  G  +EA+E+   +       D   Y+ +   L K  ++    +LF  + +     D+ TYNI+I +    G++D+A ++F ++E     PD +++N+L+    +N +  +       M E+ + PD  T S +++   K E
Sbjct:  392 HRLFCDMWSFPVKGERDSYMSMLESLCGAGKTIEAIEMLSKIHEKGVVTDTMMYNTVFSALGKLKQISHIHDLFEKMKKDGPSPDIFTYNILIASFGRVGEVDEAINIFEELERSDCKPDIISYNSLINCLGKNGDVDEAHVRFKEMQEKGLNPDVVTYSTLMECFGKTE 561          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP328_ARATH (Pentatricopeptide repeat-containing protein At4g20740 OS=Arabidopsis thaliana GN=At4g20740 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.040e-14
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLS-IVVDLLVKNEIS 501
            D +AY   I  L   G +  +L ++  +R  + + D+ +Y  L+ GLCK GR++  +ELF  +    ++ D   Y ++I    ADGK+  A +L+ D+   G   D   +N ++ G    N+  K  +L     E  + PD  TLS I+V  +V N +S
Sbjct:  297 DVFAYTAMIKTLVSEGNLDASLRVWDEMRRDEIKPDVMAYGTLVVGLCKDGRVERGYELFMEMKGKQILIDREIYRVLIEGFVADGKVRSACNLWEDLVDSGYIADIGIYNAVIKGLCSVNQVDKAYKLFQVAIEEELEPDFETLSPIMVAYVVMNRLS 455          

HSP 2 Score: 77.411 bits (189), Expect = 1.155e-13
Identity = 39/169 (23.08%), Postives = 84/169 (49.70%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSI 513
            +  G+  ++  +   + GLCK G I E LE+ + +R   C+ D+ +Y+ +I  L   G L  +  ++  + R  +  DV+ Y  ++  LC DG++++ ++LF++M+ K +  D   +  L+ G + + +      L   + +   I D      + + ++K   S+N +
Sbjct:  255 KEDGLVEESTTFMILVKGLCKAGRIEEMLEILQRMRENLCKPDVFAYTAMIKTLVSEGNLDASLRVWDEMRRDEIKPDVMAYGTLVVGLCKDGRVERGYELFMEMKGKQILIDREIYRVLIEGFVADGKVRSACNLWEDLVDSGYIADIG----IYNAVIKGLCSVNQV 419          

HSP 3 Score: 77.0258 bits (188), Expect = 1.509e-13
Identity = 44/142 (30.99%), Postives = 71/142 (50.00%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDE 432
            RR  +  D  AY T + GLCK+G +    ELF  ++  +  +D   Y  LI+G    G+++ A  L+  L     IAD+  YN +I  LC+  ++DKA+ LF     + + PD    + +M+  +  N  S    +L R+ E
Sbjct:  325 RRDEIKPDVMAYGTLVVGLCKDGRVERGYELFMEMKGKQILIDREIYRVLIEGFVADGKVRSACNLWEDLVDSGYIADIGIYNAVIKGLCSVNQVDKAYKLFQVAIEEELEPDFETLSPIMVAYVVMNRLSDFSNVLERIGE 466          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR49_ARATH (Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.185e-14
Identity = 47/158 (29.75%), Postives = 77/158 (48.73%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            R G   +T  Y   I    +  Y+ EA+ +F  ++   C+ D  +Y  LID   K+G L IA +++  +  G L  D  TY+++I+ L   G +  AH LF +M  +G  P+ V +N +M    +       ++L   M      PD  T SIV+++L
Sbjct:  392 RDGCQPNTVTYNRLIHSYGRANYLNEAMNVFNQMQEAGCKPDRVTYCTLIDIHAKAGFLDIAMDMYQRMQAGGLSPDTFTYSVIINCLGKAGHLPAAHKLFCEMVDQGCTPNLVTYNIMMDLHAKARNYQNALKLYRDMQNAGFEPDKVTYSIVMEVL 549          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP432_ARATH (Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 5.185e-14
Identity = 45/157 (28.66%), Postives = 79/157 (50.32%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            +R+GV      Y   IDGLCKNG++ EA+ L   +     + DI +YS LI+G CK GR K A E+   + R  L  + + Y+ +I+  C  G + +A  ++  M  +G   D   FN L+    +  + ++  E +  M    ++P+  +   +++
Sbjct:  395 KRNGVCVGRITYTGMIDGLCKNGFLDEAVVLLNEMSKDGIDPDIVTYSALINGFCKVGRFKTAKEIVCRIYRVGLSPNGIIYSTLIYNCCRMGCLKEAIRIYEAMILEGHTRDHFTFNVLVTSLCKAGKVAEAEEFMRCMTSDGILPNTVSFDCLIN 551          

HSP 2 Score: 78.1814 bits (191), Expect = 6.772e-14
Identity = 43/161 (26.71%), Postives = 82/161 (50.93%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            + G A     Y T +   CK G    A+EL   ++    + D+ +Y+ LI  LC+S R+   + L   + + ++  + VTYN +I+    +GK+  A  L  +M + G++P+ V FN L+ G I      + +++ + M+ + + P   +  +++D L KN
Sbjct:  221 KSGYAPTIVTYNTVLHWYCKKGRFKAAIELLDHMKSKGVDADVCTYNMLIHDLCRSNRIAKGYLLLRDMRKRMIHPNEVTYNTLINGFSNEGKVLIASQLLNEMLSFGLSPNHVTFNALIDGHISEGNFKEALKMFYMMEAKGLTPSEVSYGVLLDGLCKN 381          

HSP 3 Score: 76.6406 bits (187), Expect = 1.970e-13
Identity = 43/155 (27.74%), Postives = 75/155 (48.39%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV-DLLVKNEIS 501
            Y   I    + G I ++LE+FR + +      + + + ++  + KSG     W     + +  +  DV T+NI+I+ LCA+G  +K+  L   ME  G AP  V +NT++    +       +ELL  M  + V  D  T ++++ DL   N I+
Sbjct:  126 YDILIRVYLREGMIQDSLEIFRLMGLYGFNPSVYTCNAILGSVVKSGEDVSVWSFLKEMLKRKICPDVATFNILINVLCAEGSFEKSSYLMQKMEKSGYAPTIVTYNTVLHWYCKKGRFKAAIELLDHMKSKGVDADVCTYNMLIHDLCRSNRIA 280          

HSP 4 Score: 70.8626 bits (172), Expect = 1.081e-11
Identity = 42/149 (28.19%), Postives = 72/149 (48.32%), Query Frame = 1
Query:   34 WAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKG-VAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + Y + + GLCK G++ EA +  ++L  +   +D   Y+ L+  +CKSG L  A  LF  + +  ++ D  TY  +I  LC  GK   A     + EA+G V P+ V +   + G  +  +    +    +MD     PD  T + ++D
Sbjct:  579 FTYGSLLKGLCKGGHLREAEKFLKSLHAVPAAVDTVMYNTLLTAMCKSGNLAKAVSLFGEMVQRSILPDSYTYTSLISGLCRKGKTVIAILFAKEAEARGNVLPNKVMYTCFVDGMFKAGQWKAGIYFREQMDNLGHTPDIVTTNAMID 727          

HSP 5 Score: 70.4774 bits (171), Expect = 1.412e-11
Identity = 47/159 (29.56%), Postives = 75/159 (47.17%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            GV AD   Y   I  LC++  I +   L R +R      +  +Y+ LI+G    G++ IA +L + +    L  + VT+N +I    ++G   +A  +F  MEAKG+ P  V++  L+ G  +N E         RM    V     T + ++D L KN
Sbjct:  258 GVDADVCTYNMLIHDLCRSNRIAKGYLLLRDMRKRMIHPNEVTYNTLINGFSNEGKVLIASQLLNEMLSFGLSPNHVTFNALIDGHISEGNFKEALKMFYMMEAKGLTPSEVSYGVLLDGLCKNAEFDLARGFYMRMKRNGVCVGRITYTGMIDGLCKN 416          

HSP 6 Score: 70.0922 bits (170), Expect = 1.844e-11
Identity = 42/153 (27.45%), Postives = 73/153 (47.71%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            +  D   +   I+ LC  G   ++  L + +        I +Y+ ++   CK GR K A EL   +    + ADV TYN++IH LC   ++ K + L  DM  + + P+ V +NTL+ G     +     +LL+ M    + P+  T + ++D
Sbjct:  189 ICPDVATFNILINVLCAEGSFEKSSYLMQKMEKSGYAPTIVTYNTVLHWYCKKGRFKAAIELLDHMKSKGVDADVCTYNMLIHDLCRSNRIAKGYLLLRDMRKRMIHPNEVTYNTLINGFSNEGKVLIASQLLNEMLSFGLSPNHVTFNALID 341          

HSP 7 Score: 69.3218 bits (168), Expect = 3.146e-11
Identity = 41/158 (25.95%), Postives = 72/158 (45.57%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   D + +   +  LCK G + EA E  R +       +  S+ CLI+G   SG    A+ +F  + +        TY  ++  LC  G + +A      + A   A D V +NTL+    ++   +K V L   M +R+++PD+ T + ++  L +
Sbjct:  503 GHTRDHFTFNVLVTSLCKAGKVAEAEEFMRCMTSDGILPNTVSFDCLINGYGNSGEGLKAFSVFDEMTKVGHHPTFFTYGSLLKGLCKGGHLREAEKFLKSLHAVPAAVDTVMYNTLLTAMCKSGNLAKAVSLFGEMVQRSILPDSYTYTSLISGLCR 660          

HSP 8 Score: 68.1662 bits (165), Expect = 7.008e-11
Identity = 40/158 (25.32%), Postives = 76/158 (48.10%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G+     +Y   +DGLCKN     A   +  ++     +   +Y+ +IDGLCK+G L  A  L + + +  +  D+VTY+ +I+  C  G+   A ++   +   G++P+ + ++TL+  C R     + + +   M       D  T +++V  L K
Sbjct:  363 GLTPSEVSYGVLLDGLCKNAEFDLARGFYMRMKRNGVCVGRITYTGMIDGLCKNGFLDEAVVLLNEMSKDGIDPDIVTYSALINGFCKVGRFKTAKEIVCRIYRVGLSPNGIIYSTLIYNCCRMGCLKEAIRIYEAMILEGHTRDHFTFNVLVTSLCK 520          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP437_ARATH (Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.772e-14
Identity = 46/154 (29.87%), Postives = 74/154 (48.05%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G+  +   Y   ID  C+ G +  AL     +     +L +  Y+ LI+G CK G +  A      +    L   VVTY  ++   C+ GK++KA  L+ +M  KG+AP    F TL+ G  R       V+L + M E NV P+  T +++++
Sbjct:  397 GLRPNDVTYSILIDMFCRRGKLDTALSFLGEMVDTGLKLSVYPYNSLINGHCKFGDISAAEGFMAEMINKKLEPTVVTYTSLMGGYCSKGKINKALRLYHEMTGKGIAPSIYTFTTLLSGLFRAGLIRDAVKLFNEMAEWNVKPNRVTYNVMIE 550          

HSP 2 Score: 77.7962 bits (190), Expect = 8.845e-14
Identity = 55/183 (30.05%), Postives = 81/183 (44.26%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILK---------CELDI--------------------------RSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDAST 459
            G   +   Y   I+GLCK G++ EA  L   ++ +          C LDI                           +Y+ LI G C+ GR++ A EL   +    +  D +TY  MI+ LC    + KA +L+  M  KG+ PD VA+NTL+ GC    E  K  EL + M  + +IP+  T
Sbjct:  712 GCVPNEVTYTAVINGLCKAGFVNEAEVLCSKMQPVSSVPNQVTYGCFLDILTKGEVDMQKAVELHNAILKGLLANTATYNMLIRGFCRQGRIEEASELITRMIGDGVSPDCITYTTMINELCRRNDVKKAIELWNSMTEKGIRPDRVAYNTLIHGCCVAGEMGKATELRNEMLRQGLIPNNKT 894          

HSP 3 Score: 72.4034 bits (176), Expect = 3.716e-12
Identity = 48/182 (26.37%), Postives = 77/182 (42.31%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPD----------------ASTLSIVVDLLVKNEISLNSI 513
            G+    + Y + I+G CK G I  A      +   K E  + +Y+ L+ G C  G++  A  L+H +    +   + T+  ++  L   G +  A  LF +M    V P+ V +N ++ G     + SK  E L  M E+ ++PD                AS   + VD L K    LN I
Sbjct:  432 GLKLSVYPYNSLINGHCKFGDISAAEGFMAEMINKKLEPTVVTYTSLMGGYCSKGKINKALRLYHEMTGKGIAPSIYTFTTLLSGLFRAGLIRDAVKLFNEMAEWNVKPNRVTYNVMIEGYCEEGDMSKAFEFLKEMTEKGIVPDTYSYRPLIHGLCLTGQASEAKVFVDGLHKGNCELNEI 613          

HSP 4 Score: 68.9366 bits (167), Expect = 4.109e-11
Identity = 39/146 (26.71%), Postives = 70/146 (47.95%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            Y   I+G C+ G + +A E  + +       D  SY  LI GLC +G+   A      L +G    + + Y  ++H  C +GK+++A  +  +M  +GV  D V +  L+ G +++ +      LL  M +R + PD    + ++D
Sbjct:  545 YNVMIEGYCEEGDMSKAFEFLKEMTEKGIVPDTYSYRPLIHGLCLTGQASEAKVFVDGLHKGNCELNEICYTGLLHGFCREGKLEEALSVCQEMVQRGVDLDLVCYGVLIDGSLKHKDRKLFFGLLKEMHDRGLKPDDVIYTSMID 690          
The following BLAST results are available for this feature:
BLAST of FC928858 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
PP339_ARATH1.782e-1427.67Pentatricopeptide repeat-containing protein At4g26... [more]
PP131_ARATH1.782e-1430.50Pentatricopeptide repeat-containing protein At1g79... [more]
PP338_ARATH2.328e-1426.45Pentatricopeptide repeat-containing protein At4g26... [more]
PP282_ARATH2.328e-1428.48Pentatricopeptide repeat-containing protein At3g54... [more]
PP123_ARATH2.328e-1431.88Pentatricopeptide repeat-containing protein At1g74... [more]
PPR76_ARATH3.040e-1429.03Pentatricopeptide repeat-containing protein At1g51... [more]
PP328_ARATH3.040e-1430.19Pentatricopeptide repeat-containing protein At4g20... [more]
PPR49_ARATH5.185e-1429.75Pentatricopeptide repeat-containing protein At1g18... [more]
PP432_ARATH5.185e-1428.66Pentatricopeptide repeat-containing protein At5g55... [more]
PP437_ARATH6.772e-1429.87Putative pentatricopeptide repeat-containing prote... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1CB01RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CB01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928858 ID=FC928858|Name=FC928858|organism=Citrus clementina|type=EST|length=866bp
GGCACGAGGCGTCATGGCGTGGCAGCTGATACCTGGGCATATAGAACCTT
TATTGATGGGCTCTGCAAGAATGGTTATATTGTAGAGGCACTTGAACTAT
TTCGTACTTTGAGAATTCTCAAGTGTGAACTTGATATTCGATCCTACAGC
TGCCTCATTGATGGATTATGTAAATCCGGCAGACTCAAAATTGCATGGGA
ACTATTTCATAGTTTGCCTCGTGGAGTCCTAATAGCAGATGTTGTAACAT
ATAACATCATGATCCATGCGCTTTGTGCTGATGGAAAAATGGACAAGGCA
CATGATTTGTTTCTTGATATGGAAGCAAAAGGTGTAGCACCCGATTGTGT
CGCATTTAACACGCTGATGCTAGGTTGCATCCGCAATAATGAGACATCAA
AAGTTGTTGAACTCCTTCACAGAATGGATGAGAGAAATGTGATACCAGAT
GCATCTACACTTTCAATTGTTGTGGACTTACTTGTAAAGAATGAAATTAG
CTTAAACTCCATTCCACAATTCAAGAGTCAAAGGTAAGTGAGTTTAATAT
TGATTTAGTCGCATGTTTCTTCTGCCTGAAAACCCGATCTGGAGGATCCC
ATTCTTATTAACACGTGTAAAGGAGTGTTGTCTAATGTTGGCATGTTCCT
AGGTTCTGTCCATGGATTCTGTTTGCAGACATGGCTAACTTCTTGTCCAA
CAGATAAGTTTTAAAGTCTTTCAACTTTATGTTGTAAAATAACATTTTCA
TTATTCAATTCATGAGTTTTCCTTCTGTATCACATACTTCTCATTAGCTG
GAAGCGCAAATTTTTTAGGCTTTTCCTGTATGGCCTCTTTTTCTGCTCTA
AATAAAATGGCATTTT
back to top