FC929171

Overview
NameFC929171
Unique NameFC929171
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length799
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5224 contig Ccv1_Contig5224:297..1095. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929171 vs. ExPASy Swiss-Prot
Match: CHI4_SOLTU (Endochitinase 4 (Fragment) OS=Solanum tuberosum GN=CHTB4 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 4.508e-62
Identity = 110/173 (63.58%), Postives = 130/173 (75.14%), Query Frame = 1
Query:   22 EREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCG 528
            +REIAAFFAQT HETTGGWP AP G YAWGYCF+ E   P DYC P+  +PC    KY+GRGPIQ+S NYNY  C           NNPDL+ATDPV+SFKSAIWFWMT Q PKPSCH+VII  W+PSA D  A RLPG+G+ TNIINGG+ECG+G ++ V++RIGF+  +CG
Sbjct:  131 KREIAAFFAQTSHETTGGWPTAPDGPYAWGYCFLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLL--NNPDLVATDPVISFKSAIWFWMTPQSPKPSCHDVIIGRWQPSAADRAANRLPGFGVITNIINGGLECGRGSDSRVQDRIGFYRRYCG 301          
BLAST of FC929171 vs. ExPASy Swiss-Prot
Match: CHIB_VITVI (Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 5.888e-62
Identity = 111/200 (55.50%), Postives = 138/200 (69.00%), Query Frame = 1
Query:   22 EREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYGLNLMAQSM 609
            +REIAAF AQT HETTGGW  AP G YAWGYC++ E   P  YC P+  +PC    KYYGRGPIQ+S+NYNY +            NNPDL+ATD V+SFK+A WFWMT Q PKPSCH VI   W PS  D +AGRLPG+G+ TNIINGG+ECG+G    V++RIGF+  +C    +  G++LDC NQRP+G  L+  ++
Sbjct:  117 KREIAAFLAQTSHETTGGWASAPDGPYAWGYCYLREQGSPGAYCVPSAQWPCAAGRKYYGRGPIQISYNYNYGQAGKAIGVDLV--NNPDLVATDAVISFKTAFWFWMTPQSPKPSCHNVITGGWTPSGADRSAGRLPGFGVITNIINGGVECGKGVVPQVQDRIGFYKRYCDILRVSYGNNLDCNNQRPFGSGLLLDTI 314          
BLAST of FC929171 vs. ExPASy Swiss-Prot
Match: CHI3_ORYSJ (Chitinase 3 OS=Oryza sativa subsp. japonica GN=Cht3 PE=2 SV=2)

HSP 1 Score: 236.498 bits (602), Expect = 1.312e-61
Identity = 110/192 (57.29%), Postives = 134/192 (69.79%), Query Frame = 1
Query:   22 EREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSD-YCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPY 582
            +RE+AAF AQT HETTGGWP AP G Y+WGYCF  E +  +  YC+P   +PC    KYYGRGPIQ+++NYNY              NNPDL+A+D  +SFK+A WFWMT Q PKPSCH VI  +W PSA+D  AGR+PGYG  TNIINGG+ECG G +  V +RIGF+  +C   G+  GD+LDCYNQRPY
Sbjct:  128 KREVAAFLAQTSHETTGGWPTAPDGPYSWGYCFKEENNGNAPTYCEPKPEWPCAAGKKYYGRGPIQITYNYNY--GPAGQAIGSDLLNNPDLVASDATVSFKTAFWFWMTPQSPKPSCHAVITGQWTPSADDQAAGRVPGYGEITNIINGGVECGHGADDKVADRIGFYKRYCDMLGVSYGDNLDCYNQRPY 317          
BLAST of FC929171 vs. ExPASy Swiss-Prot
Match: CHIX_PEA (Endochitinase OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.922e-61
Identity = 110/191 (57.59%), Postives = 135/191 (70.68%), Query Frame = 1
Query:   19 EEREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDP-NYPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPY 582
            +++E+AAF AQT HETTGGWP AP G YAWGYCF+SE +    YC P ++PC    KYYGRGPIQL+ NYNY              NNPDLL+T+P +SFK+AIWFWMT Q  KPS H+VI   W PSA D +AGR+PGYG+ TNIINGGIECG G +  V +R+GF+  +C  FG+ PG +LDC NQR +
Sbjct:  131 KKKELAAFLAQTSHETTGGWPTAPDGPYAWGYCFVSEQNTQEVYCSPKDWPCAPGKKYYGRGPIQLTHNYNY--GLAGQAIKEDLINNPDLLSTNPTVSFKTAIWFWMTPQANKPSSHDVITGRWTPSAADSSAGRVPGYGVITNIINGGIECGHGQDNRVDDRVGFYKRYCQIFGVDPGGNLDCNNQRSF 319          
BLAST of FC929171 vs. ExPASy Swiss-Prot
Match: CHID_SOLLC (Basic endochitinase (Fragment) OS=Solanum lycopersicum GN=CHI14 PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.894e-60
Identity = 107/191 (56.02%), Postives = 130/191 (68.06%), Query Frame = 1
Query:   25 REIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYG 585
            +EIAAF AQT HETTGGW  AP G Y+WGYC+  E   P DYC     +PC    KY+GRGPIQ+S+NYNY              NNPDL+A D V+SFK+A+WFWMTAQ PKPS H+VI   W PS  D   GR+PG+G+ TNIINGG+EC  G NA + NRIGF+  +C   G+ PG++LDC NQRP+G
Sbjct:   58 KEIAAFLAQTSHETTGGWATAPDGPYSWGYCYNREQGSPGDYCASSQQWPCAPGKKYFGRGPIQISYNYNYGAAGSAIGVNLL--NNPDLVANDAVVSFKTALWFWMTAQQPKPSAHDVITGRWSPSVADSAPGRVPGFGVITNIINGGMECNSGSNALMDNRIGFYRRYCQILGVDPGNNLDCANQRPFG 246          
BLAST of FC929171 vs. ExPASy Swiss-Prot
Match: CHIC_SECCE (Basic endochitinase C OS=Secale cereale GN=rscc PE=1 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 4.220e-60
Identity = 108/191 (56.54%), Postives = 132/191 (69.11%), Query Frame = 1
Query:   22 EREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPY 582
            +R++AAF AQT HETTGGW  AP G +AWGYCF  E    +DYC P+  +PC    +YYGRGPIQLS NYNY               NPDL+ATDP +SFK+A+WFWMTAQ PKPS H VI  +W PS  D  AGR PG+G+ TNIINGG+ECG G ++ V +RIGF+  +C   G+  GD+LDCYNQRP+
Sbjct:   77 KRDVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGAAADYCTPSAQWPCAPGKRYYGRGPIQLSHNYNY--GPAGRAIGVDLLRNPDLVATDPTVSFKTALWFWMTAQAPKPSSHAVITGKWSPSGADRAAGRAPGFGVITNIINGGLECGHGQDSRVADRIGFYKRYCDILGVGYGDNLDCYNQRPF 265          
BLAST of FC929171 vs. ExPASy Swiss-Prot
Match: CHI2_HORVU (26 kDa endochitinase 2 OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 5.511e-60
Identity = 109/192 (56.77%), Postives = 133/192 (69.27%), Query Frame = 1
Query:   19 EEREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPY 582
            ++RE+AAF AQT HETTGGW  AP G +AWGYCF  E    SDYC P+  +PC    +YYGRGPIQLS NYNY               NPDL+ATD  + FK+AIWFWMTAQPPKPS H VI  +W PS  D  AGR+PG+G+ TNIINGGIECG G ++ V +RIGF+  +C   G+  G++LDCY+QRP+
Sbjct:   76 QKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGASSDYCTPSAQWPCAPGKRYYGRGPIQLSHNYNYGPAGRAIGVDLLA--NPDLVATDATVGFKTAIWFWMTAQPPKPSSHAVIAGQWSPSGADRAAGRVPGFGVITNIINGGIECGHGQDSRVADRIGFYKRYCDILGVGYGNNLDCYSQRPF 265          
BLAST of FC929171 vs. ExPASy Swiss-Prot
Match: CHI1_HORVU (26 kDa endochitinase 1 OS=Hordeum vulgare PE=2 SV=4)

HSP 1 Score: 229.95 bits (585), Expect = 1.228e-59
Identity = 109/191 (57.07%), Postives = 134/191 (70.16%), Query Frame = 1
Query:   22 EREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPY 582
            +RE+AAF AQT HETTGGW  AP G +AWGYCF  E    S+YC P+  +PC  GK YYGRGPIQLS NYNY               NPDL+ATDP +SFK+A+WFWMTAQ PKPS H VI  +W PS  D  AGR+PG+G+ TNI+NGGIECG G ++ V +RIGF+  +C   G+  G++LDCY+QRP+
Sbjct:  129 KREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGATSNYCTPSAQWPCAPGKSYYGRGPIQLSHNYNY--GPAGRAIGVDLLRNPDLVATDPTVSFKTAMWFWMTAQAPKPSSHAVITGQWSPSGTDRAAGRVPGFGVITNIVNGGIECGHGQDSRVADRIGFYKRYCDILGVGYGNNLDCYSQRPF 317          
BLAST of FC929171 vs. ExPASy Swiss-Prot
Match: CHIA_SECCE (Basic endochitinase A OS=Secale cereale GN=rsca PE=1 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.735e-59
Identity = 109/191 (57.07%), Postives = 133/191 (69.63%), Query Frame = 1
Query:   22 EREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPY 582
            +RE+AAF AQT HETTGGW  AP G +AWGYCF  E    S+YC P+  +PC  GK YYGRGPIQLS NYNY               NPDL+ATDP +SFK+A+WFWMTAQ PKPS H VI  +W PS  D  AGR+PG+G+ TNI+NGGIECG G ++ V +RIGF+  +C    +  G++LDCYNQRP+
Sbjct:  132 KREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGATSNYCTPSAQWPCAPGKSYYGRGPIQLSHNYNY--GPAGRAIGVDLLRNPDLVATDPTVSFKTAMWFWMTAQAPKPSSHAVITGQWSPSGTDRAAGRVPGFGVITNIVNGGIECGHGQDSRVADRIGFYKRYCDILRVGYGNNLDCYNQRPF 320          
BLAST of FC929171 vs. ExPASy Swiss-Prot
Match: CHI1_ORYSJ (Chitinase 1 OS=Oryza sativa subsp. japonica GN=Cht1 PE=2 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.735e-59
Identity = 106/193 (54.92%), Postives = 132/193 (68.39%), Query Frame = 1
Query:   22 EREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPP--SDYC--DPNYPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPY 582
            +RE+AAF AQT HETTGGW  AP G Y+WGYCF  E +    SDYC     +PC    KYYGRGPIQ+S+NYNY              +NPDL+A+D  +SFK+A WFWMT Q PKPSCH V+  +W P+ ND  AGR+PGYG+ TNIINGG+ECG G ++ V +RIGF+  +C   G+  G +LDCYNQRP+
Sbjct:  131 KREVAAFLAQTSHETTGGWATAPDGPYSWGYCFKEENNGNVGSDYCVQSSQWPCAAGKKYYGRGPIQISYNYNY--GPAGQAIGSNLLSNPDLVASDATVSFKTAFWFWMTPQSPKPSCHAVMTGQWTPNGNDQAAGRVPGYGVVTNIINGGVECGHGADSRVADRIGFYKRYCDMLGVSYGANLDCYNQRPF 321          
The following BLAST results are available for this feature:
BLAST of FC929171 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHI4_SOLTU4.508e-6263.58Endochitinase 4 (Fragment) OS=Solanum tuberosum GN... [more]
CHIB_VITVI5.888e-6255.50Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE... [more]
CHI3_ORYSJ1.312e-6157.29Chitinase 3 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIX_PEA2.922e-6157.59Endochitinase OS=Pisum sativum PE=2 SV=1[more]
CHID_SOLLC1.894e-6056.02Basic endochitinase (Fragment) OS=Solanum lycopers... [more]
CHIC_SECCE4.220e-6056.54Basic endochitinase C OS=Secale cereale GN=rscc PE... [more]
CHI2_HORVU5.511e-6056.7726 kDa endochitinase 2 OS=Hordeum vulgare PE=1 SV=... [more]
CHI1_HORVU1.228e-5957.0726 kDa endochitinase 1 OS=Hordeum vulgare PE=2 SV=... [more]
CHIA_SECCE2.735e-5957.07Basic endochitinase A OS=Secale cereale GN=rsca PE... [more]
CHI1_ORYSJ2.735e-5954.92Chitinase 1 OS=Oryza sativa subsp. japonica GN=Cht... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3CH04RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3CH04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929171 ID=FC929171; Name=FC929171; organism=Citrus clementina; type=EST; length=799bp
CTCGTGCGAATTCGGCACGAGGAAAGAGAAATCGCTGCCTTTTTTGCCCA
AACTGGCCATGAAACTACTGGGGGATGGCCCGATGCACCTGGTGGCGAAT
ATGCTTGGGGATATTGCTTTATAAGCGAAGTTAGCCCTCCGTCCGACTAC
TGTGATCCTAACTATCCATGTCGAGGGAAGTACTATGGCCGAGGTCCAAT
TCAACTCTCTTGGAATTACAATTACTTACGGTGCGGAGAAGGCCTAGGGC
TAGGAGAGGAGTTGTTGAACAATCCAGACCTTCTTGCTACTGATCCAGTA
CTATCATTCAAGTCAGCAATCTGGTTCTGGATGACTGCACAGCCACCAAA
GCCATCGTGCCACGAAGTCATTATCGACGAATGGAAACCATCAGCAAATG
ACGTAAACGCCGGCCGGCTTCCGGGATACGGTCTAACCACAAATATAATC
AACGGTGGAATTGAATGTGGCCAAGGTGGGAATGCCGCTGTACGTAACCG
TATTGGGTTCTTTACCACTTTCTGTGGCAAGTTTGGGATTCAGCCTGGTG
ACAGTCTTGATTGCTACAACCAACGACCTTATGGCCTTAATCTGATGGCA
CAATCTATGTGATCATCATGATCAACGTTTTAGTAAAATAAGCTTAATAA
AAGCTACTTAATAAAAACTTTAGATGTCACACTTGTAGGTGGACAACTAA
ATTGTTAGTTTGTTACGCTCTTATTGTAAGTAAATTAAATAAGACTGATC
CAACATGGATCAATGAGTCTTCACCATCTTTCAAAAAAAAAAAAAAAAA
back to top