FC929176

Overview
NameFC929176
Unique NameFC929176
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length798
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14139 contig Ccv1_Contig14139:137..934. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: UDG_SHIFL (Putative UDP-glucose 6-dehydrogenase OS=Shigella flexneri GN=udg PE=5 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.611e-19
Identity = 79/257 (30.74%), Postives = 120/257 (46.69%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDK--IVVEKSTVPVK-TAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKDILNLV 781
            EV  +DI  SR+   N    PI +  +   ++  +   + F+  ++K+ +  D  +V + TPT           +     S   VI DV + +   ++V KSTVPV  TA   +K  T N       I+ +PEFL EG A+ D  +P R++IG R     + A    +      +P    L T+   AE  KL AN +LA R++  N + +  E+ G N  Q+   V  D RIG  + N S G+GG C  KD   L+
Sbjct:   24 EVVALDILPSRVAMLNDRISPIVDKEIQQFLQSDK---IHFNATLDKNEAYRDADYVIIATPTDYD-----PKTNYFNTSSVESVIKDVVEINPYAVMVIKSTVPVGFTAAMHKKYRTEN-------IIFSPEFLREGKALYDNLHPSRIVIGERSERAERFAALLQEGAIKQNIPT---LFTDSTEAEAIKLFANTYLAMRVAYFNELDSYAESLGLNTRQIIEGVCLDPRIGNHYNNPSFGYGGYCLPKDTKQLL 262          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: UDG_ECOLI (UDP-glucose 6-dehydrogenase OS=Escherichia coli (strain K12) GN=ugd PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.611e-19
Identity = 79/257 (30.74%), Postives = 121/257 (47.08%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDK--IVVEKSTVPVK-TAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKDILNLV 781
            EV  +DI  SR+   N    PI +  +   ++  +   + F+  ++K+ +  D  +V + TPT           +     S   VI DV + +   ++V KSTVPV  TA   +K  T N       I+ +PEFL EG A+ D  +P R++IG R     + A    +      +P   +L T+   AE  KL AN +LA R++  N + +  E+ G N  Q+   V  D RIG  + N S G+GG C  KD   L+
Sbjct:   24 EVVALDILPSRVAMLNDRISPIVDKEIQQFLQSDK---IHFNATLDKNEAYRDADYVIIATPTDYD-----PKTNYFNTSSVESVIKDVVEINPYAVMVIKSTVPVGFTAAMHKKYRTEN-------IIFSPEFLREGKALYDNLHPSRIVIGERSERAERFAALLQEGAIKQNIP---MLFTDSTEAEAIKLFANTYLAMRVAYFNELDSYAESLGLNSRQIIEGVCLDPRIGNHYNNPSFGYGGYCLPKDTKQLL 262          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: UDG_ECOL6 (UDP-glucose 6-dehydrogenase OS=Escherichia coli O6 GN=ugd PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.611e-19
Identity = 79/257 (30.74%), Postives = 120/257 (46.69%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDK--IVVEKSTVPVK-TAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKDILNLV 781
            EV  +DI  SR+   N    PI +  +   ++  +   + F+  ++K+ +  D  +V + TPT           +     S   VI DV + +   ++V KSTVPV  TA   +K  T N       I+ +PEFL EG A+ D  +P R++IG R     + A    +      +P    L T+   AE  KL AN +LA R++  N + +  E+ G N  Q+   V  D RIG  + N S G+GG C  KD   L+
Sbjct:   24 EVVALDILPSRVAMLNDRISPIVDKEIQQFLQSDK---IHFNATLDKNEAYRDADYVIIATPTDYD-----PKTNYFNTSSVESVIKDVVEINPYAVMVIKSTVPVGFTAAMHKKYRTEN-------IIFSPEFLREGKALYDNLHPSRIVIGERSERAERFAALLQEGAIKQNIPT---LFTDSTEAEAIKLFANTYLAMRVAYFNELDSYAESLGLNTRQIIEGVCLDPRIGNHYNNPSFGYGGYCLPKDTKQLL 262          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: UDG5_ECOLX (UDP-glucose 6-dehydrogenase OS=Escherichia coli GN=kfiD PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 6.124e-19
Identity = 73/254 (28.74%), Postives = 119/254 (46.85%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKDILNLV 781
            EV   D    +++  N    PI +  ++  +     K L F     K+ +  +  +V + TPT           D +  E+  R + +++ +  I+V KSTVPV   + I++ L  N+      I+ +PEFL EG A+ D  +P R++IG       + AV   +      +P   +L T+   AE  KL +N +LA R++  N + +  E+ G N  Q+   V  D RIG  + N S G+GG C  KD   L+
Sbjct:   28 EVVAFDTHQKKVDLLNDKLSPIEDKEIENYLST---KILNFRATTNKYEAYKNANYVIIATPTNYDP--GSNYFDTSSVEAVIRDVTEINPN-AIMVVKSTVPVGFTKTIKEHLGINN------IIFSPEFLREGRALYDNLHPSRIIIGECSERAERLAVLFQEGAIKQNIP---VLFTDSTEAEAIKLFSNTYLAMRVAFFNELDSYAESFGLNTRQIIDGVCLDPRIGNYYNNPSFGYGGYCLPKDTKQLL 266          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: ALGD_AZOVI (GDP-mannose 6-dehydrogenase OS=Azotobacter vinelandii GN=algD PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 6.124e-19
Identity = 75/269 (27.88%), Postives = 126/269 (46.84%), Query Frame = 2
Query:    8 GPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQ-CRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAAR----VIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNS---KGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSR--IGPKFLNASVGFGGSCFQKDILNLVY 784
            G   EV  VDIS ++I+  N  + PI EPGL  ++ +  +   L  +T+V + V   ++  + V TP+K  G       +L Y E   R     + D ++   +VV  + +P      +  IL   S    G+ F +  NPEFL E TAI+D   P   +IG  +   G++    L  +YA    +  I+   +  AE+ K   N + A +++  N +  + +A G +  +V   V  D++  +   ++   + FGGSC  KD+  L Y
Sbjct:   21 GRGHEVVGVDISAAKIDMINQGKSPIVEPGLGELLAEGVKTGRLRGTTNVTEAVLATELSMLCVGTPSKLNG-----DLELDYIEEVCRQMGSALRDKTERHTVVVRSTVLPGTVHNVVIPILEEFSGKKAGVDFGVAVNPEFLRESTAIKDYNFPPMTVIGELDKASGRR----LASIYAEL--DAPIVRKGIAVAEMIKYTCNVWHATKVTFANEIGNIAKAAGVDGREVMEVVCMDNKLNLSQYYMRPGLAFGGSCLPKDVSALSY 278          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: WECC_METM7 (UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=wecC PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 7.998e-19
Identity = 77/250 (30.80%), Postives = 116/250 (46.40%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQC-RGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            EV  VD++  R+N   + +L I EPGL  +VK     KNL   T  E    EAD   + V TP      G+ K  DLTY  SA + I    K   ++V +ST+P +T + I + +       K  +   PE +  G  +++L   DR+ IGG      +K+ +  K++Y  +V E +I  T+  +AE+ KL  N +    I+  N  + +C+  G NV           R+    LN   G GG C   D
Sbjct:   34 EVVGVDVNEKRVNHIKNGELKIEEPGLLTLVKGAINSKNLNVQTSAE----EADAFIICVPTPALENEDGS-KKCDLTYVMSAVQAIIPFLKDGNLIVVESTIPPETTKKIYETINK-----KIYVAHCPERVLPGKILKELVENDRI-IGG----INKKSAEMAKEIYKSFV-EGKIYITDSNTAEMVKLMENTYRDINIALANEFAKICDEIGVNVWDAIKIANKHPRV--NILNPGPGVGGHCISID 265          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: WECC_METMP (UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis GN=wecC PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.045e-18
Identity = 76/250 (30.40%), Postives = 118/250 (47.20%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQC-RGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            +V  VD++  R+N   + +L I EPGL  +VK     KNL    +V    +EAD   + V TP   +  G+ K  DL+Y  SA   I    K   ++V +ST+P +T + I + L       K  +   PE +  G  +++L   DR+ IGG      +K+ +  K++Y  +V E +I TT+  +AE+ KL  N +    I+  N  + +C+  G NV           R+    LN   G GG C   D
Sbjct:   34 DVVGVDVNEKRVNQIKNGELKIEEPGLLTLVKGAINSKNL----NVRTSATEADAFIICVPTPALAKEDGS-KKCDLSYVMSAVEAILPFVKDGNLIVIESTIPPETTKKIYETLNK-----KIYVAHCPERVLPGKILKELVENDRI-IGGIN----KKSAEMAKEIYKSFV-EGQIYTTDSNTAEMVKLMENTYRDINIALANEFAKICDEIGVNVWDAIKIANKHPRV--NILNPGPGVGGHCISID 265          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: UDG_SALTY (UDP-glucose 6-dehydrogenase OS=Salmonella typhimurium GN=udg PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.045e-18
Identity = 76/259 (29.34%), Postives = 118/259 (45.56%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPT----KTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVK-TAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKDILNLV 781
            +V  +DI  SR+   N    PI +  +   +K+    N+ F   ++K  +  +  +V + TPT    KT              ES  + +  ++ +  +++ KSTVPV  TA   +K  T N       I+ +PEFL EG A+ D   P R++IG +     + A    +      +P    L T+   AE  KL AN +LA R++  N + +  E  G N  Q+   V  D RIG  + N S G+GG C  KD   L+
Sbjct:   24 DVVALDIVPSRVELLNDRISPIVDKEIQQFLKE---DNIRFRATLDKFDAYQNADYVIIATPTDYDPKTNYFNTSSV------ESVMQDVISINPAAVMII-KSTVPVGFTAAMRQKFATEN-------IIFSPEFLREGKALYDNLYPSRIVIGEQSERAREFAALLQEGAIKQEIPT---LFTDSTEAEAIKLFANTYLAMRVAYFNELDSYAETLGLNTRQIIEGVCLDPRIGNHYNNPSFGYGGYCLPKDTKQLL 262          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: EPSD1_RALSO (NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum GN=epsD PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.508e-17
Identity = 73/259 (28.19%), Postives = 117/259 (45.17%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKF----------QILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            EV  VDI+   ++  N  ++ I EP LD +V+    +    +T   +    AD   ++V TP         K  DL+Y E+AAR IA V K   +VV +ST PV   E +   L+     + F          ++   PE +  G  +++L   DR++  G  TP+  +A + L +++       R + T+  +AE+ KL  NAF    I+  N +S +C+  G NV ++        R+    L    G GG C   D
Sbjct:   34 EVIGVDINQHAVDTINQGRIHIVEPDLDMLVRAAVSQGYLRATTEPE---PADAFLIAVPTPFLDN-----KQPDLSYIEAAARAIAPVLKRGDLVVLESTSPVGATEQLSDWLSAQRPDLSFPHQQGEESDIRVAHCPERVLPGHVLRELVENDRII--GGMTPKCSEAAQRLYELFV----RGRCIVTDARTAEMCKLTENAFRDVNIAFANELSMICDEIGVNVWELISVANRHPRV--NILQPGPGVGGHCIAVD 276          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: EPSD2_RALSO (NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum GN=epsD PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.970e-17
Identity = 72/259 (27.80%), Postives = 116/259 (44.79%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKF----------QILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            E+  VDI+   ++  N  ++ I EP LD +V+    +    +T   +    AD   ++V TP         K  DLTY E+AA+ IA V K   +VV +ST PV   E +   L+     + F          ++   PE +  G  +++L   DR++  G  TP   +A + L +++       R + T+  +AE+ KL  NAF    I+  N +S +C+  G NV ++        R+    L    G GG C   D
Sbjct:   34 ELIGVDINQHAVDTINQARIHIVEPDLDMLVRAAVSQGYLRATTEPE---PADAFLIAVPTPFLED-----KQPDLTYIEAAAKAIAPVLKRGDLVVLESTSPVGATEQLSAWLSEQRSDLSFPHQLGEESDIRVAHCPERVLPGHVLRELVENDRII--GGMTPRCSQAAQRLYELFVR----GRCIVTDARTAEMCKLTENAFRDVNIAFANELSMICDEIGVNVWELISVANRHPRV--NILQPGPGVGGHCIAVD 276          
The following BLAST results are available for this feature:
BLAST of FC929176 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
UDG_SHIFL1.611e-1930.74Putative UDP-glucose 6-dehydrogenase OS=Shigella f... [more]
UDG_ECOLI1.611e-1930.74UDP-glucose 6-dehydrogenase OS=Escherichia coli (s... [more]
UDG_ECOL61.611e-1930.74UDP-glucose 6-dehydrogenase OS=Escherichia coli O6... [more]
UDG5_ECOLX6.124e-1928.74UDP-glucose 6-dehydrogenase OS=Escherichia coli GN... [more]
ALGD_AZOVI6.124e-1927.88GDP-mannose 6-dehydrogenase OS=Azotobacter vinelan... [more]
WECC_METM77.998e-1930.80UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methan... [more]
WECC_METMP1.045e-1830.40UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methan... [more]
UDG_SALTY1.045e-1829.34UDP-glucose 6-dehydrogenase OS=Salmonella typhimur... [more]
EPSD1_RALSO1.508e-1728.19NDP-N-acetyl-D-galactosaminuronic acid dehydrogena... [more]
EPSD2_RALSO1.970e-1727.80NDP-N-acetyl-D-galactosaminuronic acid dehydrogena... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3CH10RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3CH10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929176 ID=FC929176; Name=FC929176; organism=Citrus clementina; type=EST; length=798bp
GGCACGAGGCCCATCCATTGAAGTGGCTGTTGTTGATATCTCTGTGTCTC
GGATCAATGCCTGGAACAGTGACCAGCTCCCCATCTATGAGCCTGGACTT
GATGGTGTGGTAAAGCAGTGCCGAGGGAAGAACCTGTTCTTCAGCACCGA
TGTTGAGAAGCATGTCTCTGAGGCTGATATTGTCTTTGTTTCAGTCAATA
CCCCAACCAAAACTCAGGGTCTCGGTGCTGGCAAAGCTGCAGATCTGACA
TACTGGGAGAGTGCTGCTCGTGTGATTGCCGATGTGTCAAAGTCTGACAA
AATTGTTGTTGAGAAATCAACAGTTCCTGTAAAAACTGCTGAGGCAATTG
AAAAAATTTTGACCCACAACAGCAAGGGAATCAAATTCCAGATCCTTTCA
AACCCGGAGTTTCTTGCTGAGGGAACTGCAATACAGGATCTTTTTAACCC
AGATCGGGTCCTTATCGGTGGTAGAGAAACGCCAGAAGGCCAGAAAGCCG
TCAAAGCCTTGAAGGATGTGTATGCACACTGGGTCCCAGAAGACCGAATT
TTGACCACCAACCTGTGGTCTGCAGAGCTTTCGAAGCTTGCAGCCAATGC
TTTCTTGGCACAGAGGATCTCATCTGTTAATGCCATGTCAGCTCTCTGCG
AGGCAACTGGAGCTAATGTCAGTCAGGTGGCATTTGCTGTTGGTACAGAC
TCTAGGATTGGGCCCAAATTCTTGAATGCTAGTGTTGGGTTCGGTGGCTC
CTGCTTCCAGAAAGATATTTTGAATCTGGTTTACATCTGCGAGTGCAA
back to top