FC929176

Overview
NameFC929176
Unique NameFC929176
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length798
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14139 contig Ccv1_Contig14139:137..934. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: WECC_METM5 (UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=wecC PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.360e-17
Identity = 74/250 (29.60%), Postives = 116/250 (46.40%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQC-RGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            EV  VD++  R+N   + +L I EPGL  +VK     KNL    +V+   +EAD   + V TP      G+ K  DLTY   A + I    K   ++V +ST+P +  + I + +       K  +   PE +  G  +++L   DR+ IGG      +K+ +  K++Y  +V E +I  T+  +AE+ KL  N +    I+  N  + +C+  G NV           R+    LN   G GG C   D
Sbjct:   34 EVVGVDVNEKRVNQIKNGELKIEEPGLLTLVKGAINSKNL----NVQTSATEADAFIICVPTPALENEDGS-KKCDLTYVMGAVQNIIPFLKEGNLIVIESTIPPEITKKIYETIDK-----KIYVAHCPERVLPGKILKELVENDRI-IGGIN----KKSAEMAKEIYKSFV-EGKIYITDSNTAEMVKLMENTYRDINIALANEFAKICDEIGVNVWDAIKIANKHPRV--NILNPGPGVGGHCISID 265          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: WECC_METVS (UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=wecC PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.081e-15
Identity = 75/250 (30.00%), Postives = 111/250 (44.40%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQC-RGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            EV  VDIS  R+N   +    I EPGL  ++K     KNL   T  EK    AD   + V TP      G+ K  DL+Y   A   I        ++V +ST+P +T + I  I+       K  +   PE +  G  +++L   DR+ IGG      +K+ +  K++Y  +V E +I  T+  +AE+ KL  N +    I+  N  + +C+  G NV           R+    LN   G GG C   D
Sbjct:   34 EVIGVDISEKRVNEIKNGDFKIEEPGLLTLLKGAINSKNLNVKTKAEK----ADAFIICVPTPAIGCDDGS-KKCDLSYVLDAVNSILPYIDEGNLIVIESTIPPETTQKIYDIIDK-----KVYVAHCPERVLPGKILKELVENDRI-IGGIN----KKSAEMAKEIYKSFV-EGKIYITDSNTAEMVKLMENTYRDINIALANEFAKICDEIGVNVWDAIKIANKHPRV--NILNPGPGVGGHCISID 265          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: WECC_SHIFL (UDP-N-acetyl-D-mannosamine dehydrogenase OS=Shigella flexneri GN=wecC PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 7.006e-15
Identity = 78/260 (30.00%), Postives = 110/260 (42.31%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQC-RGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKF----------QILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            +V  VDI+   ++  N  ++ I EP L  VVK    G  L  ST       EAD   ++V TP K          D+TY ESAAR IA V K   +V+ +ST PV + E + + L      + F           I   PE +  G  + +L   DRV+  G  TP        L  ++     E   + TN  +AE+ KL  N+F    I+  N +S +C   G NV ++        R+    L    G GG C   D
Sbjct:   28 QVIGVDINQHAVDTINRGEIHIVEPDLASVVKTAVEGGFLRASTTPV----EADAWLIAVPTPFK-----GDHEPDMTYVESAARSIAPVLKKGALVILESTSPVGSTEKMAEWLAEMRPDLTFPQQVGEQADVNIAYCPERVLPGQVMVELIKNDRVI--GGMTPVCSARASELYKIFL----EGECVVTNSRTAEMCKLTENSFRDVNIAFANELSLICADQGINVWELIRLANRHPRV--NILQPGPGVGGHCIAVD 270          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: WECC_ECOLI (UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli (strain K12) GN=wecC PE=3 SV=4)

HSP 1 Score: 81.2629 bits (199), Expect = 7.006e-15
Identity = 78/260 (30.00%), Postives = 110/260 (42.31%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQC-RGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKF----------QILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            +V  VDI+   ++  N  ++ I EP L  VVK    G  L  ST       EAD   ++V TP K          D+TY ESAAR IA V K   +V+ +ST PV + E + + L      + F           I   PE +  G  + +L   DRV+  G  TP        L  ++     E   + TN  +AE+ KL  N+F    I+  N +S +C   G NV ++        R+    L    G GG C   D
Sbjct:   28 QVIGVDINQHAVDTINRGEIHIVEPDLASVVKTAVEGGFLRASTTPV----EADAWLIAVPTPFK-----GDHEPDMTYVESAARSIAPVLKKGALVILESTSPVGSTEKMAEWLAEMRPDLTFPQQVGEQADVNIAYCPERVLPGQVMVELIKNDRVI--GGMTPVCSARASELYKIFL----EGECVVTNSRTAEMCKLTENSFRDVNIAFANELSLICADQGINVWELIRLANRHPRV--NILQPGPGVGGHCIAVD 270          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: WECC_ECO57 (UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli O157:H7 GN=wecC PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 7.006e-15
Identity = 78/260 (30.00%), Postives = 110/260 (42.31%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQC-RGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKF----------QILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            +V  VDI+   ++  N  ++ I EP L  VVK    G  L  ST       EAD   ++V TP K          D+TY ESAAR IA V K   +V+ +ST PV + E + + L      + F           I   PE +  G  + +L   DRV+  G  TP        L  ++     E   + TN  +AE+ KL  N+F    I+  N +S +C   G NV ++        R+    L    G GG C   D
Sbjct:   28 QVIGVDINQHAVDTINRGEIHIVEPDLASVVKTAVEGGFLRASTTPV----EADAWLIAVPTPFK-----GDHEPDMTYVESAARSIAPVLKKGALVILESTSPVGSTEKMAEWLAEMRPDLTFPQQVGEQADVNIAYCPERVLPGQVMVELIKNDRVI--GGMTPVCSARASELYKIFL----EGECVVTNSRTAEMCKLTENSFRDVNIAFANELSLICADQGINVWELIRLANRHPRV--NILQPGPGVGGHCIAVD 270          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: WECC_YERPE (UDP-N-acetyl-D-mannosamine dehydrogenase OS=Yersinia pestis GN=wecC PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.662e-14
Identity = 74/260 (28.46%), Postives = 109/260 (41.92%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVK-QCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKF----------QILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            +V  VD++   +   N   + I EP LD VVK    G  L   T  +     AD   ++V TP K          D+ + ESAA+ IA V K   +V+ +ST PV   E + + L      + F           I   PE +  G  + +L   DRV+  G  TP+      AL  ++     E   + TN  +AE+ KL  N+F    I+  N +S +C+  G NV ++        R+    L    G GG C   D
Sbjct:   28 KVIGVDVNAHAVETINRGAIHIVEPDLDKVVKIAVEGGYLQAVTKPQA----ADAFLIAVPTPFK-----GDHEPDMIFVESAAKSIAPVLKKGDLVILESTSPVGATEQMAQWLAEARPDLSFPQQAGEAADINIAYCPERVLPGQVMVELIQNDRVI--GGMTPKCSARASALYKIFL----EGECVVTNSRTAEMCKLTENSFRDVNIAFANELSLICDEQGINVWELIRLANRHPRV--NILQPGPGVGGHCIAVD 270          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: WECC_SALTI (UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhi GN=wecC PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.477e-14
Identity = 73/259 (28.19%), Postives = 106/259 (40.93%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKF----------QILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            +V  VDI+   ++  N  ++ I EP L  VVK         +T       EAD   ++V TP K          D+ Y E+AA+ IA V K   +V+ +ST PV   E +   L      + F           I   PE +  G  + +L   DRV+  G  TP       AL  ++     E   + TN  +AE+ KL  N+F    I+  N +S +C   G NV ++        R+    L    G GG C   D
Sbjct:   28 QVIGVDINQHAVDTINRGEIHIVEPALGNVVKMAVEGGFLRATTTP---VEADAYLIAVPTPFK-----GDHDPDMAYVEAAAKSIAPVLKKGALVILESTSPVGATEQMAGWLAGMRPDLTFPQQAGEQADVNIAYCPERVLPGQVMVELIKNDRVI--GGMTPVCSARASALYKIFL----EGECVVTNSRTAEMCKLTENSFRDVNIAFANELSLICAEQGINVWELIRLANRHPRV--NILQPGPGVGGHCIAVD 270          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: UDG_STRP3 (UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes serotype M3 GN=hasB PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.477e-14
Identity = 68/261 (26.05%), Postives = 114/261 (43.68%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVK-TAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDR------ILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKDILNLV 781
            EV +VDI  S+++  N+   PI +  ++  +K    K L     ++   +  +   V + TPT           D  + E+  + +  V+    +++ KST+P+    E  +K  T        +I+ +PEFL E  A+ D   P R+++   E    +  VKA  + +A  +          +L      AE  KL AN +LA R++  N +    E+   N   V   +  D RIG  + N S G+GG C  KD   L+
Sbjct:   24 EVTIVDILPSKVDKINNGLSPIQDEYIEYYLKS---KQLSIKATLDSKAAYKEAELVIIATPTNYNS--RINYFDTQHVETVIKEVLSVNSHATLII-KSTIPIGFITEMRQKFQTD-------RIIFSPEFLRESKALYDNLYPSRIIVSCEENDSPK--VKADAEKFALLLKSAAKKNNVPVLIMGASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMVIQGISYDDRIGMHYNNPSFGYGGYCLPKDTKQLL 269          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: WECC_SALTY (UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhimurium GN=wecC PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.541e-14
Identity = 73/259 (28.19%), Postives = 106/259 (40.93%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKF----------QILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKD 766
            +V  VDI+   ++  N  ++ I EP L  VVK         +T       EAD   ++V TP K          D+ Y E+AA+ IA V K   +V+ +ST PV   E +   L      + F           I   PE +  G  + +L   DRV+  G  TP       AL  ++     E   + TN  +AE+ KL  N+F    I+  N +S +C   G NV ++        R+    L    G GG C   D
Sbjct:   28 QVIGVDINQHAVDIINRGEIHIVEPALGNVVKMAVEGGFLRATTTP---VEADAYLIAVPTPFK-----GDHDPDMAYVEAAAKSIAPVLKKGALVILESTSPVGATEQMAGWLAGMRTDLTFPQQAGEQADVNIAYCPERVLPGQVMVELIKNDRVI--GGMTPVCSARASALYKIFL----EGECVVTNSRTAEMCKLTENSFRDVNIAFANELSLICAEQGINVWELIRLANRHPRV--NILQPGPGVGGHCIAVD 270          
BLAST of FC929176 vs. ExPASy Swiss-Prot
Match: UDG_STRPY (UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes GN=hasB PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.541e-14
Identity = 67/261 (25.67%), Postives = 114/261 (43.68%), Query Frame = 2
Query:   20 EVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVK-TAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDR------ILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVSQVAFAVGTDSRIGPKFLNASVGFGGSCFQKDILNLV 781
            EV +VDI  S+++  N+   PI +  ++  +K    K L     ++   +  +   V + TPT           D  + E+  + +  V+    +++ KST+P+    E  +K  T        +I+ +PEFL E  A+ D   P R+++   E    +  VKA  + +A  +          +L      AE  KL AN +LA R++  N +    E+   N   +   +  D RIG  + N S G+GG C  KD   L+
Sbjct:   24 EVTIVDILPSKVDKINNGLSPIQDEYIEYYLKS---KQLSIKATLDSKAAYKEAELVIIATPTNYNS--RINYFDTQHVETVIKEVLSVNSHATLII-KSTIPIGFITEMRQKFQTD-------RIIFSPEFLRESKALYDNLYPSRIIVSCEENDSPK--VKADAEKFALLLKSAAKKNNVPVLIMGASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGISYDDRIGMHYNNPSFGYGGYCLPKDTKQLL 269          
The following BLAST results are available for this feature:
BLAST of FC929176 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
WECC_METM53.360e-1729.60UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methan... [more]
WECC_METVS1.081e-1530.00UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methan... [more]
WECC_SHIFL7.006e-1530.00UDP-N-acetyl-D-mannosamine dehydrogenase OS=Shigel... [more]
WECC_ECOLI7.006e-1530.00UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escher... [more]
WECC_ECO577.006e-1530.00UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escher... [more]
WECC_YERPE2.662e-1428.46UDP-N-acetyl-D-mannosamine dehydrogenase OS=Yersin... [more]
WECC_SALTI3.477e-1428.19UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmon... [more]
UDG_STRP33.477e-1426.05UDP-glucose 6-dehydrogenase OS=Streptococcus pyoge... [more]
WECC_SALTY4.541e-1428.19UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmon... [more]
UDG_STRPY4.541e-1425.67UDP-glucose 6-dehydrogenase OS=Streptococcus pyoge... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3CH10RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3CH10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929176 ID=FC929176; Name=FC929176; organism=Citrus clementina; type=EST; length=798bp
GGCACGAGGCCCATCCATTGAAGTGGCTGTTGTTGATATCTCTGTGTCTC
GGATCAATGCCTGGAACAGTGACCAGCTCCCCATCTATGAGCCTGGACTT
GATGGTGTGGTAAAGCAGTGCCGAGGGAAGAACCTGTTCTTCAGCACCGA
TGTTGAGAAGCATGTCTCTGAGGCTGATATTGTCTTTGTTTCAGTCAATA
CCCCAACCAAAACTCAGGGTCTCGGTGCTGGCAAAGCTGCAGATCTGACA
TACTGGGAGAGTGCTGCTCGTGTGATTGCCGATGTGTCAAAGTCTGACAA
AATTGTTGTTGAGAAATCAACAGTTCCTGTAAAAACTGCTGAGGCAATTG
AAAAAATTTTGACCCACAACAGCAAGGGAATCAAATTCCAGATCCTTTCA
AACCCGGAGTTTCTTGCTGAGGGAACTGCAATACAGGATCTTTTTAACCC
AGATCGGGTCCTTATCGGTGGTAGAGAAACGCCAGAAGGCCAGAAAGCCG
TCAAAGCCTTGAAGGATGTGTATGCACACTGGGTCCCAGAAGACCGAATT
TTGACCACCAACCTGTGGTCTGCAGAGCTTTCGAAGCTTGCAGCCAATGC
TTTCTTGGCACAGAGGATCTCATCTGTTAATGCCATGTCAGCTCTCTGCG
AGGCAACTGGAGCTAATGTCAGTCAGGTGGCATTTGCTGTTGGTACAGAC
TCTAGGATTGGGCCCAAATTCTTGAATGCTAGTGTTGGGTTCGGTGGCTC
CTGCTTCCAGAAAGATATTTTGAATCTGGTTTACATCTGCGAGTGCAA
back to top