FC929261

Overview
NameFC929261
Unique NameFC929261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length823
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12949 contig Ccv1_Contig12949:141..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_YEAST (Mannose-1-phosphate guanyltransferase OS=Saccharomyces cerevisiae GN=MPG1 PE=1 SV=2)

HSP 1 Score: 302.753 bits (774), Expect = 1.569e-81
Identity = 148/225 (65.78%), Postives = 183/225 (81.33%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEEST-GKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MK LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM+  LK++E + G+ I  S ETEPLGTAGPL LA D L  D   PFFVLNSDVI EYPF E+ +FHKAHGG+ +I+ TKVDEPSKYGV+V + +T   +++FVEKPK FVGN+INAG+Y+LNP V+D IE++PTSIEKE FP +  E +L++  L GFWMD+GQP+
Sbjct:    1 MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVMVETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKD-NSPFFVLNSDVICEYPFKELADFHKAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRFVEKPKEFVGNRINAGLYILNPEVIDLIEMKPTSIEKETFPILVEEKQLYSFDLEGFWMDVGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_SCHPO (Mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe GN=mpg1 PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 4.566e-81
Identity = 151/225 (67.11%), Postives = 181/225 (80.44%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVV-TEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGGFGTRLRPLTL++PKPLVEF NKPMILHQ+EAL A GVT++VLA+NY+PE+M+  LK++E +  + I  S E EPLGTAGPLALARD L  D   PFFVLNSDVI EYPFA++  FHKAHG E +I+VTKV+EPSKYGVVV    S   +E+FVEKP  FV N+IN GIY+LNP+VLDRIE RPTSIEKEVFP +  + +L +  L G+WMD+GQP+
Sbjct:    1 MKALILVGGFGTRLRPLTLTLPKPLVEFGNKPMILHQVEALAAAGVTDIVLAVNYRPEIMVEALKKYEKEYNVNITFSVENEPLGTAGPLALARDILAKD-HSPFFVLNSDVICEYPFADLAAFHKAHGAEGTIVVTKVEEPSKYGVVVHYPNSESLIERFVEKPVEFVSNRINGGIYILNPSVLDRIEPRPTSIEKEVFPAMVNDKQLHSFDLEGYWMDVGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_ASPOR (Mannose-1-phosphate guanyltransferase OS=Aspergillus oryzae GN=mpg1 PE=3 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 4.566e-81
Identity = 146/225 (64.89%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEES-TGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGGFGTRLRPLTL++PKPLVEF N+PMILHQ+E+L A GVT++VLA+NY+P+VM++ LK++E +  +KI  S E+EPLGTAGPL LA +K++     PFFVLNSDVI +YPF E+ EFHK HG E +I+VTKVDEPSKYGVVV + +   ++++FVEKP  FVGN+INAGIY++NP+VL+RIELRPTSIE+E FP I  +G+L +  L GFWMD+GQP+
Sbjct:    1 MKALILVGGFGTRLRPLTLTLPKPLVEFGNRPMILHQVESLAAAGVTDIVLAVNYRPDVMVSALKKYEEQYNVKIEFSVESEPLGTAGPLKLA-EKILGKDDSPFFVLNSDVICDYPFKELAEFHKKHGDEGTIVVTKVDEPSKYGVVVHKPNHPSRIDRFVEKPVEFVGNRINAGIYIMNPSVLNRIELRPTSIEQETFPAICKDGQLHSFDLEGFWMDVGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPB_DANRE (Mannose-1-phosphate guanyltransferase beta OS=Danio rerio GN=gmppb PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 4.566e-81
Identity = 146/224 (65.18%), Postives = 186/224 (83.04%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGG+GTRLRPLTL+VPKPLVEF NKP++LHQ+EAL   GV  V+LA++Y  E++   ++  E +LGIKI  S E EPLGTAGPLALAR+ L+ D  EPFFVLNSDVI ++PF +M++FH+ HG E +I+VTKV+EPSKYGVVV E  +G++ +FVEKP++FV NKINAG+Y+ +PA+L RI+LRPTSIEKE+FP +A EG+L+AM L GFWMDIGQP+
Sbjct:    1 MKALILVGGYGTRLRPLTLTVPKPLVEFCNKPILLHQVEALVKAGVRHVILAVSYMSELLEREMRAQEQRLGIKISLSHEKEPLGTAGPLALARE-LLTDNQEPFFVLNSDVICDFPFDDMLKFHQQHGREGTIVVTKVEEPSKYGVVVYEGDSGRIHRFVEKPQVFVSNKINAGMYIFSPAMLRRIQLRPTSIEKEIFPVMAEEGQLYAMELQGFWMDIGQPK 223          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPB_CAEBR (Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis briggsae GN=tag-335 PE=3 SV=2)

HSP 1 Score: 300.827 bits (769), Expect = 5.964e-81
Identity = 150/224 (66.96%), Postives = 184/224 (82.14%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGG+GTRLRPLTL+ PKPLVEFANKPM+LHQ+EAL AVGV  VVLA++Y+ E +   +     +LG+K+I S E EPLGTAGPLALAR  L DD  +PFFVLNSDVI ++PF +M+EFHK HG E +I VTKV+EPSKYGVVV +E  GK++ FVEKP+ +VGNKINAG+Y+ N A+LDRI L+PTSIEKE+FP++A  G L+A VLPGFWMD+GQP+
Sbjct:    1 MKALILVGGYGTRLRPLTLTQPKPLVEFANKPMMLHQMEALAAVGVDTVVLAVSYRAEQLEAEMTVHADRLGVKLIFSLEEEPLGTAGPLALARKHLEDD--DPFFVLNSDVICDFPFKQMVEFHKQHGKEGTIAVTKVEEPSKYGVVVFKED-GKIDDFVEKPQEYVGNKINAGLYIFNSAILDRIPLKPTSIEKEIFPQMATSGNLYAYVLPGFWMDVGQPK 221          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_NEUCR (Mannose-1-phosphate guanyltransferase OS=Neurospora crassa GN=mpg-1 PE=3 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.735e-80
Identity = 150/226 (66.37%), Postives = 183/226 (80.97%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKL-IDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEES-TGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGGFGTRLRPLTL++PKPLVEF NK MILHQIEAL A GVT++VLA+NY+PE+M  +L E+E + GI I  S E+EPLGTAGPL LA D L  DDT  PFFVLNSDV  EYPF E+  FHKAHG E +I+VTKV+EPSKYGVVV + +   ++++FVEKP  FVGN+INAG+Y+ NP+V+DR+ELRPTSIE+E FP +  +G+L +  L GFWMDIGQP+
Sbjct:    1 MKALILVGGFGTRLRPLTLTMPKPLVEFGNKRMILHQIEALAAAGVTDIVLAVNYRPEIMEKYLAEYEKQFGINITISIESEPLGTAGPLKLAEDVLRKDDT--PFFVLNSDVTCEYPFKELAAFHKAHGDEGTIVVTKVEEPSKYGVVVHKPNHPSRIDRFVEKPVQFVGNRINAGLYIFNPSVIDRVELRPTSIEQETFPAMVRDGQLHSFDLEGFWMDIGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_ASHGO (Mannose-1-phosphate guanyltransferase OS=Ashbya gossypii GN=MPG1 PE=3 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 3.866e-80
Identity = 145/225 (64.44%), Postives = 182/225 (80.89%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEEST-GKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MK LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM+  LK++E + G+ I  S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPF E+  FH+AHGG+ +I+ TKVDEPSKYGV+V + +T   +++FVEKP  FVGN+INAG+Y+LNP V+D IELRPTSIEKE FP +  +  L++  L G+WMD+GQP+
Sbjct:    1 MKGLILVGGYGTRLRPLTLTVPKPLVEFCNRPMILHQIEALAAAGVTDIVLAVNYRPEVMVETLKKYEKQYGVSITFSVETEPLGTAGPLKLA-EKVLKKDNSPFFVLNSDVICEYPFKELAAFHRAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRFVEKPVEFVGNRINAGLYILNPEVIDLIELRPTSIEKETFPILVEQKSLYSFDLEGYWMDVGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_ASPFU (Mannose-1-phosphate guanyltransferase OS=Aspergillus fumigatus GN=mpg1 PE=2 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 6.594e-80
Identity = 144/225 (64.00%), Postives = 185/225 (82.22%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEES-TGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGGFGTRLRPLTL++PKPLVEF N+PMILHQ+E+L A GVT++VLA+NY+P+VM+  LK++E +  ++I  S E+EPLGTAGPL LA +K++     PFFVLNSD+I +YPF ++ EFHK HG E +I+VTKVDEPSKYGVVV + +   ++++FVEKP  FVGN+INAGIY+LNP+VL RIELRPTSIE+E FP I  +G+L +  L GFWMD+GQP+
Sbjct:    1 MKALILVGGFGTRLRPLTLTLPKPLVEFGNRPMILHQVESLAAAGVTDIVLAVNYRPDVMVAALKKYEEQYNVRIEFSVESEPLGTAGPLKLA-EKILGKDDSPFFVLNSDIICDYPFKQLAEFHKKHGDEGTIVVTKVDEPSKYGVVVHKPNHPSRIDRFVEKPVEFVGNRINAGIYILNPSVLKRIELRPTSIEQETFPAICSDGQLHSFDLEGFWMDVGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPB_CAEEL (Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis elegans GN=tag-335 PE=3 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 1.469e-79
Identity = 145/224 (64.73%), Postives = 180/224 (80.36%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGG+GTRLRPLTL+ PKPLVEFANKPM+LHQ+EAL  VGV  VVLA++Y+ E +   +     +LG+K+I S E EPLGTAGPLALAR  L  D   PFFVLNSDVI ++PF +M+EFHK HG E +I VTKV+EPSKYGVVV ++  GK++ FVEKP+ +VGNKINAG+Y+ +  +LDRI L+PTSIEKE+FP++A  G L+A VLPGFWMD+GQP+
Sbjct:    1 MKALILVGGYGTRLRPLTLTQPKPLVEFANKPMMLHQMEALAEVGVDTVVLAVSYRAEQLEQEMTVHADRLGVKLIFSLEEEPLGTAGPLALARKHLEGDA--PFFVLNSDVICDFPFKQMVEFHKNHGKEGTIAVTKVEEPSKYGVVVFDQDKGKIDDFVEKPQEYVGNKINAGLYIFSSKILDRIPLKPTSIEKEIFPEMAFSGNLYAFVLPGFWMDVGQPK 222          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_TRIRE (Mannose-1-phosphate guanyltransferase OS=Trichoderma reesei GN=mpg1 PE=1 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 2.506e-79
Identity = 145/225 (64.44%), Postives = 181/225 (80.44%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEES-TGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MK LILVGGFGTRLRPLTL++PKPLVEF NKPMI+HQIEAL A GVT++VLA+NY+PE+M  FL E+E K  I I  S E+EPL TAGPL LA ++++     PFFVLNSDVI +YPF E++EFHKAHG E +I+VTKV+EPSKYGVVV + +   ++++FVEKP  FVGN+INAG+Y+ NP+VL RIELRPTSIEKE FP +  + +L +  L GFWMD+GQP+
Sbjct:    1 MKGLILVGGFGTRLRPLTLTLPKPLVEFCNKPMIVHQIEALVAAGVTDIVLAVNYRPEIMEKFLAEYEEKYNINIEFSVESEPLDTAGPLKLA-ERILGKDDSPFFVLNSDVICDYPFKELLEFHKAHGDEGTIVVTKVEEPSKYGVVVHKPNHPSRIDRFVEKPVEFVGNRINAGMYIFNPSVLKRIELRPTSIEKETFPAMVADNQLHSFDLEGFWMDVGQPK 224          
The following BLAST results are available for this feature:
BLAST of FC929261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
MPG1_YEAST1.569e-8165.78Mannose-1-phosphate guanyltransferase OS=Saccharom... [more]
MPG1_SCHPO4.566e-8167.11Mannose-1-phosphate guanyltransferase OS=Schizosac... [more]
MPG1_ASPOR4.566e-8164.89Mannose-1-phosphate guanyltransferase OS=Aspergill... [more]
GMPPB_DANRE4.566e-8165.18Mannose-1-phosphate guanyltransferase beta OS=Dani... [more]
GMPPB_CAEBR5.964e-8166.96Mannose-1-phosphate guanyltransferase beta OS=Caen... [more]
MPG1_NEUCR1.735e-8066.37Mannose-1-phosphate guanyltransferase OS=Neurospor... [more]
MPG1_ASHGO3.866e-8064.44Mannose-1-phosphate guanyltransferase OS=Ashbya go... [more]
MPG1_ASPFU6.594e-8064.00Mannose-1-phosphate guanyltransferase OS=Aspergill... [more]
GMPPB_CAEEL1.469e-7964.73Mannose-1-phosphate guanyltransferase beta OS=Caen... [more]
MPG1_TRIRE2.506e-7964.44Mannose-1-phosphate guanyltransferase OS=Trichoder... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DC11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DC11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929261 ID=FC929261|Name=FC929261|organism=Citrus clementina|type=EST|length=823bp
GCAAAGCAAAAGCGAAGCGCGCGAAGCTCGCCTCATCCGTTGACTGAGCT
GTCGGTCCCGAGTCACGACTCGCGACTCTTGTTTTTGAACTCAGTTGTTT
GCCGTTCGGATCCGGTCTTAATTAAAGGATAAAGCAGGCTCCGTATCACA
ATGAAGGCACTTATTCTTGTTGGAGGGTTCGGAACACGGTTGAGGCCGTT
GACGCTTAGTGTCCCTAAGCCACTTGTTGAATTTGCTAACAAACCCATGA
TCCTGCATCAGATAGAGGCCCTTAAGGCAGTTGGAGTGACTGAAGTAGTT
TTGGCTATTAACTACCAGCCAGAGGTGATGTTGAACTTTTTGAAGGAATT
TGAAGCAAAGCTTGGGATCAAGATCATCTGCTCACAAGAGACTGAGCCAC
TGGGCACTGCTGGTCCTCTGGCTCTGGCTAGAGACAAATTGATTGACGAT
ACTGGTGAGCCATTTTTCGTCCTTAACAGTGATGTTATTAGTGAGTACCC
ATTTGCAGAAATGATTGAATTCCACAAAGCACATGGAGGAGAGGCCTCCA
TCATGGTAACCAAGGTGGATGAGCCATCAAAATATGGTGTGGTGGTTACG
GAAGAGTCTACTGGAAAAGTTGAGAAATTCGTTGAGAAACCTAAATTATT
TGTTGGTAACAAAATTAATGCTGGAATTTATCTTTTGAACCCTGCGGTTC
TTGATCGCATTGAGCTGAGGCCCACCTCCATTGAGAAAGAGGTCTTTCCA
AAAATTGCTTTAGAAGGAAAGCTCTTCGCGATGGTTCTTCCAGGTTTCTG
GATGGACATTGGACAGCCGAGGG
back to top