FC929261

Overview
NameFC929261
Unique NameFC929261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length823
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12949 contig Ccv1_Contig12949:141..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_PICAN (Mannose-1-phosphate guanyltransferase OS=Pichia angusta GN=MPG1 PE=3 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 4.274e-79
Identity = 143/225 (63.56%), Postives = 179/225 (79.56%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEEST-GKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MK LILVGG+GTRLRPLTLS+PKPLVEF N+PMILHQIEAL   G T++VLA+NY+PEVM+  LK++E + G+ I  S E EPLGTAGPL LA +K++     P FVLNSDVI EYP  +++EFH AHGGEA+I+ TKVDEPSKYGV+V +      +E+FVEKP  FVGN+INAGIY+LNP+V+D IE+RPTSIE E FP +  + KL++  LPG+WMD+GQP+
Sbjct:    1 MKGLILVGGYGTRLRPLTLSLPKPLVEFGNRPMILHQIEALANAGCTDIVLAVNYKPEVMVGALKQYEKEYGVSITFSVEEEPLGTAGPLKLA-EKILKKDNTPIFVLNSDVICEYPLRDLLEFHTAHGGEATIVATKVDEPSKYGVIVHDRDVPNLIERFVEKPVEFVGNRINAGIYVLNPSVIDLIEMRPTSIEHETFPILVEQKKLYSFDLPGYWMDVGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_KLULA (Mannose-1-phosphate guanyltransferase OS=Kluyveromyces lactis GN=MPG1 PE=1 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 5.582e-79
Identity = 143/225 (63.56%), Postives = 181/225 (80.44%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEEST-GKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MK LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM+  LK++E + G+ I  S ETEPLGTAGPL LA   L  D   PFFVLNSDVI +YPF E+ +FH+AHGG+ +I+ TKVDEPSKYGV+V + +T   +++FVEKP  FVGN+INAG+Y+LNP V+D I+L+PTSIEKE FP +  +  L++  L G+WMD+GQP+
Sbjct:    1 MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVMVETLKKYEDEFGVSITFSVETEPLGTAGPLKLAESVLKKD-NSPFFVLNSDVICDYPFKELADFHQAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRFVEKPVEFVGNRINAGLYILNPEVIDLIDLKPTSIEKETFPILVEQKSLYSFDLEGYWMDVGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_GIBZE (Mannose-1-phosphate guanyltransferase OS=Gibberella zeae GN=MPG1 PE=3 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 5.582e-79
Identity = 145/225 (64.44%), Postives = 180/225 (80.00%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEES-TGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MK LILVGG+GTRLRPLTLSVPKPLVEFANKPMI+HQIEAL A GVT++VLA+NY+PEVM  FL E+E K GI I  S ETEPL TAGPL LA ++++     PFFVLNSDVI ++PF +++ FHK+HG E +I+VTKV+EPSKYGVVV +      +++FVEKP  FVGN+INAG+Y+ N ++LDRIELRPTSIEKE FP +  + +L +  L GFWMD+GQP+
Sbjct:    1 MKGLILVGGYGTRLRPLTLSVPKPLVEFANKPMIVHQIEALVAAGVTDIVLAVNYRPEVMEKFLAEYEEKFGINIEFSVETEPLDTAGPLKLA-ERILAKDDSPFFVLNSDVICDFPFEDLLAFHKSHGNEGTIVVTKVEEPSKYGVVVHQPGHRSLIDRFVEKPVEFVGNRINAGLYIFNTSILDRIELRPTSIEKETFPAMVKDNQLHSFDLEGFWMDVGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_CANAL (Mannose-1-phosphate guanyltransferase OS=Candida albicans GN=MPG1 PE=1 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 9.521e-79
Identity = 142/225 (63.11%), Postives = 181/225 (80.44%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEEST-GKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MK LILVGG+GTRLRPLTL++PKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM++ LK++E + G+ I  S E EPLGTAGPL LA + L  D   PFFVLNSDVI +YPF E+ +FHKAHG   +I+ TKVDEPSKYGV+V +  T   +++FVEKP  FVGN+INAG+Y+LNP+V+D IE+RPTSIEKE FP +  + +L++  L G+WMD+GQP+
Sbjct:    1 MKGLILVGGYGTRLRPLTLTLPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVMVSTLKKYEEEYGVSITFSVEEEPLGTAGPLKLAEEVLKKD-DSPFFVLNSDVICDYPFKELADFHKAHGAAGTIVATKVDEPSKYGVIVHDRDTPNLIDRFVEKPVEFVGNRINAGLYILNPSVIDLIEMRPTSIEKETFPILVEQKQLYSFDLEGYWMDVGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_CRYNE (Mannose-1-phosphate guanyltransferase OS=Cryptococcus neoformans GN=MPG1 PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.624e-78
Identity = 152/224 (67.86%), Postives = 177/224 (79.02%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MKALILVGGFGTRLRPLTLS PKPLVEF NK MILHQIEAL   GV ++VLA+NY+PEVM++ LK+ E + GI I  S ETEPLGTAGPLALAR+ L  D   PFFVLNSDV   YPF    +FH AH  E SIMVTKV EPS YGVVVT+ ++  +++FVEKP  FVGN+INAGIY+ NP+VLDRIELRPTSIEKE+FP IA + +L +  L GFWMD+GQP+
Sbjct:    1 MKALILVGGFGTRLRPLTLSWPKPLVEFCNKAMILHQIEALVKAGVKDIVLAVNYRPEVMVSVLKKTEEEFGINIHFSVETEPLGTAGPLALAREILGKDDS-PFFVLNSDVTCVYPFEAFRDFHIAHKCEGSIMVTKVAEPSAYGVVVTKPNSTVIDRFVEKPVEFVGNRINAGIYIFNPSVLDRIELRPTSIEKEIFPAIAADQQLHSFDLQGFWMDVGQPK 223          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG11_CANGA (Mannose-1-phosphate guanyltransferase 1 OS=Candida glabrata GN=MPG1 PE=1 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.624e-78
Identity = 142/225 (63.11%), Postives = 181/225 (80.44%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEEST-GKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MK LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL   GVT++VLA+N +PEVM+  L+++E + G+ I  S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPF E+ +FHKAHGG+ +I+ TKVDEPSKYGV+V + +T   +++FVEKPK FVGN+INAG+Y+LNP V+D IE++PTSIE E FP +  +  L++  L GFWMD+GQP+
Sbjct:    1 MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNCRPEVMVETLQKYEKEYGVSITFSVETEPLGTAGPLKLA-EKVLKKDNSPFFVLNSDVICEYPFKELADFHKAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRFVEKPKEFVGNRINAGLYILNPEVIDLIEMKPTSIETETFPILVEQKSLYSFDLEGFWMDVGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_DEBHA (Mannose-1-phosphate guanyltransferase OS=Debaryomyces hansenii GN=MPG1 PE=3 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 3.063e-77
Identity = 139/225 (61.78%), Postives = 181/225 (80.44%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEEST-GKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            MK LILVGG+GTRLRPLTL++PKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM++ LK++EA+ G+ I  S E EPLGTAGPL LA +K++     P FVLNSDVI +YPF E+ +FHK  GG+A+I+ TKVDEPSKYGV+V +  T   +++FVEKP  FVGN+INAG+Y+LNP+V+D IE++PTSIEKE FP +    +L++  L G+WMD+GQP+
Sbjct:    1 MKGLILVGGYGTRLRPLTLTLPKPLVEFGNRPMILHQIEALAKAGVTDIVLAVNYRPEVMVSTLKKYEAEYGVTITFSVEEEPLGTAGPLKLA-EKVLKKDDTPIFVLNSDVICDYPFQELADFHKTSGGKATIVATKVDEPSKYGVIVHDRDTPNLIDRFVEKPVEFVGNRINAGLYILNPSVIDLIEMKPTSIEKETFPILVENKELYSFDLEGYWMDVGQPK 224          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPB_DROPS (Mannose-1-phosphate guanyltransferase beta OS=Drosophila pseudoobscura pseudoobscura GN=GA10892 PE=3 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 3.386e-76
Identity = 140/223 (62.78%), Postives = 183/223 (82.06%), Query Frame = 1
Query:  154 KALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            +ALILVGG+GTRLRPLTLS PKPLVEFANKP++LHQ+EAL   G  +V+LA++Y+ E M   LK    KLG+++I S ETEPLGTAGPLALA+  ++  + EPFFVLNSDVI ++PF ++++FH+ HG E +I+VTKV+EPSKYGVV+ +E  G ++ F+EKP+ FV NKINAGIY+ NP+VL+RIE++PTSIEKEVFP +A + +L+AM L GFWMDIGQP+
Sbjct:   14 RALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVILAVSYRAEQMEKELKVEADKLGVELIFSHETEPLGTAGPLALAK-SILSASPEPFFVLNSDVICDFPFKQLVQFHRNHGKEGTIVVTKVEEPSKYGVVLYDED-GCIKNFIEKPQEFVSNKINAGIYIFNPSVLERIEVKPTSIEKEVFPAMAEQQELYAMDLTGFWMDIGQPK 234          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPB_DROME (Mannose-1-phosphate guanyltransferase beta OS=Drosophila melanogaster GN=CG1129 PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 4.423e-76
Identity = 140/223 (62.78%), Postives = 183/223 (82.06%), Query Frame = 1
Query:  154 KALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            +ALILVGG+GTRLRPLTLS PKPLVEFANKP++LHQ+EAL   G  +V+LA++Y+ E M   LK    KLG+++I S ETEPLGTAGPLALA+  ++  + EPFFVLNSDVI ++PF ++++FH  HG E +I+VTKV+EPSKYGVV+ +E+ G ++ F+EKP+ FV NKINAGIY+ NP+VLDRIE++PTSIEKEVFP++  + +L+AM L GFWMDIGQP+
Sbjct:   12 RALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVILAVSYRAEQMEKELKVEAKKLGVELIFSHETEPLGTAGPLALAK-TILAASSEPFFVLNSDVICDFPFKQLVQFHCNHGKEGTIVVTKVEEPSKYGVVLYDEN-GCIKNFIEKPQEFVSNKINAGIYIFNPSVLDRIEVKPTSIEKEVFPEMTQQQELYAMDLTGFWMDIGQPK 232          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_EMENI (Mannose-1-phosphate guanyltransferase OS=Emericella nidulans GN=mpg1 PE=3 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 7.807e-73
Identity = 133/212 (62.74%), Postives = 171/212 (80.66%), Query Frame = 1
Query:  190 LRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEES-TGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDIGQPR 822
            +RPLTL++PKPLVEF N+PMILHQ+E+L A GVT++VLA+NY+P+VM++ LK++E +  +KI  S ETEPLGTAGPL LA   L  D   PFFVLNSDVI +YPF ++ EFHK HG E +I+VTKVDEPSKYGVVV + +   ++++FVEKP  FVGN+INAG+Y+LNP+VL RIELRPTSIE+E FP I  +G+L +  L GFWMD+GQP+
Sbjct:    1 MRPLTLTLPKPLVEFGNRPMILHQVESLAAAGVTDIVLAVNYRPDVMVSALKKYEEQYNVKIEFSVETEPLGTAGPLKLAESILAKD-DSPFFVLNSDVICDYPFQQLAEFHKRHGDEGTIVVTKVDEPSKYGVVVHKPNHPSRIDRFVEKPVEFVGNRINAGMYILNPSVLKRIELRPTSIEQETFPAIVRDGQLHSFDLEGFWMDVGQPK 211          
The following BLAST results are available for this feature:
BLAST of FC929261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
MPG1_PICAN4.274e-7963.56Mannose-1-phosphate guanyltransferase OS=Pichia an... [more]
MPG1_KLULA5.582e-7963.56Mannose-1-phosphate guanyltransferase OS=Kluyverom... [more]
MPG1_GIBZE5.582e-7964.44Mannose-1-phosphate guanyltransferase OS=Gibberell... [more]
MPG1_CANAL9.521e-7963.11Mannose-1-phosphate guanyltransferase OS=Candida a... [more]
MPG1_CRYNE1.624e-7867.86Mannose-1-phosphate guanyltransferase OS=Cryptococ... [more]
MPG11_CANGA1.624e-7863.11Mannose-1-phosphate guanyltransferase 1 OS=Candida... [more]
MPG1_DEBHA3.063e-7761.78Mannose-1-phosphate guanyltransferase OS=Debaryomy... [more]
GMPPB_DROPS3.386e-7662.78Mannose-1-phosphate guanyltransferase beta OS=Dros... [more]
GMPPB_DROME4.423e-7662.78Mannose-1-phosphate guanyltransferase beta OS=Dros... [more]
MPG1_EMENI7.807e-7362.74Mannose-1-phosphate guanyltransferase OS=Emericell... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DC11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DC11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929261 ID=FC929261|Name=FC929261|organism=Citrus clementina|type=EST|length=823bp
GCAAAGCAAAAGCGAAGCGCGCGAAGCTCGCCTCATCCGTTGACTGAGCT
GTCGGTCCCGAGTCACGACTCGCGACTCTTGTTTTTGAACTCAGTTGTTT
GCCGTTCGGATCCGGTCTTAATTAAAGGATAAAGCAGGCTCCGTATCACA
ATGAAGGCACTTATTCTTGTTGGAGGGTTCGGAACACGGTTGAGGCCGTT
GACGCTTAGTGTCCCTAAGCCACTTGTTGAATTTGCTAACAAACCCATGA
TCCTGCATCAGATAGAGGCCCTTAAGGCAGTTGGAGTGACTGAAGTAGTT
TTGGCTATTAACTACCAGCCAGAGGTGATGTTGAACTTTTTGAAGGAATT
TGAAGCAAAGCTTGGGATCAAGATCATCTGCTCACAAGAGACTGAGCCAC
TGGGCACTGCTGGTCCTCTGGCTCTGGCTAGAGACAAATTGATTGACGAT
ACTGGTGAGCCATTTTTCGTCCTTAACAGTGATGTTATTAGTGAGTACCC
ATTTGCAGAAATGATTGAATTCCACAAAGCACATGGAGGAGAGGCCTCCA
TCATGGTAACCAAGGTGGATGAGCCATCAAAATATGGTGTGGTGGTTACG
GAAGAGTCTACTGGAAAAGTTGAGAAATTCGTTGAGAAACCTAAATTATT
TGTTGGTAACAAAATTAATGCTGGAATTTATCTTTTGAACCCTGCGGTTC
TTGATCGCATTGAGCTGAGGCCCACCTCCATTGAGAAAGAGGTCTTTCCA
AAAATTGCTTTAGAAGGAAAGCTCTTCGCGATGGTTCTTCCAGGTTTCTG
GATGGACATTGGACAGCCGAGGG
back to top