FC929261

Overview
NameFC929261
Unique NameFC929261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length823
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12949 contig Ccv1_Contig12949:141..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: MPG1_SULAC (Putative mannose-1-phosphate guanyltransferase OS=Sulfolobus acidocaldarius GN=mpg1 PE=3 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 1.180e-28
Identity = 71/225 (31.56%), Postives = 130/225 (57.78%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMV-LPGFWMDIGQPR 822
            + A++L GG+ TRLRPL+L+ PK L+    KP++ + + +L +  V  + L++    + +L+ +K+    L   I+   E   LG AGPL     K   +  +   V+  D+ +E  F +++E+H++ G  A++  T+V++PS+YGV++T+    ++ + +EKPK  + N +NAGIY+    +L++I+    SI ++  PK+ +     ++    G WMDIG PR
Sbjct:    2 VSAIVLAGGYATRLRPLSLTKPKALLPVLGKPLMDYTLYSLASSDVDTIYLSLRVMADKVLDHVKQL--NLQKNIVSVIEESRLGDAGPLKFINSKY--NLSDDVIVVYGDIYAEIDFNKLLEYHQSKGCNATLTATQVEDPSRYGVLITDGH--RLIQIIEKPKTPLSNLVNAGIYVFKKELLNKID--GLSISRDFLPKLLVSDTCVSVYPYKGLWMDIGVPR 218          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: YBB2_SCHPO (Probable mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe GN=SPBC13G1.02 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 6.702e-24
Identity = 71/207 (34.30%), Postives = 111/207 (53.62%), Query Frame = 1
Query:  157 ALILVGG--FGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAV-GVTEVVLAINYQPEVMLNFLKEFEAKLGI--KIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI----ELRPTSIEKEV 744
            A+ILVGG   GTR RPL+  VPKPL +   + MI H + AL  +  V +V L   Y   V  +F+ E  +      +I   +E   LGT G L   RD+++       FV+++DV   +P  E++  H       ++M TKV  ++ S +G +V E STG+V  +V+KP  ++ N I+ GIY+ + ++ D I    E R   +EK++
Sbjct:    5 AVILVGGPSRGTRFRPLSFDVPKPLFKIGGREMIYHHLAALSKIESVKDVFLVGFYDESVFKDFINEVASHFPSFNRIKYLREYNCLGTGGGLYHFRDQILKGHTSNVFVMHADVCCSFPLQELLNVHHEKKALVTLMATKVSKEDASNFGCLVEEPSTGRVLHYVDKPSSYLSNIISCGIYIFDASIFDEIKKAYERRLEEVEKQL 211          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_METMP (Bifunctional protein glmU OS=Methanococcus maripaludis GN=MMP1076 PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.651e-22
Identity = 78/230 (33.91%), Postives = 116/230 (50.43%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKL--FVGNKINAGIYLLNPAVLDRIELRPTSIEKEV-----FPKIALEGKLFAMVLPGFWMDIGQP 819
            M A+IL  G GTRL P+T S PKP++  A KP+I H IE ++   V ++ L + YQ E ++++ K+       KI    + + LGT   +  A++ +  D    F VLN DVI E    E++ +      E ++ ++ VD P  +GV+       K+   +EKPK      N INAGIY L  +V   +E    S   E+       K+   GKL  + L G+W DIG P
Sbjct:    1 MDAIILCAGKGTRLHPITESRPKPMIPIAGKPIIEHIIEKIEN-HVEKIYLIVGYQKEKIIDYFKD-----NPKIEYILQEKQLGTGHAVLTAKNFIKGD----FLVLNGDVIFEDSIDEILNY------ENAVSLSNVDNPENFGVIELGYD-NKIINLLEKPKKEEITSNLINAGIYKLQNSVFGILENLAPSERGEIELTDALKKLIENGKLHGVELKGYWNDIGHP 213          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: RFBF_SALTI (Glucose-1-phosphate cytidylyltransferase OS=Salmonella typhi GN=rfbF PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.156e-22
Identity = 73/237 (30.80%), Postives = 113/237 (47.68%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQET---------EPLG-----------TAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFW 801
            MKA+IL GG GTRL   T+  PKP+VE   KP++ H ++     G+ + ++   Y+  V+  +   +   +        E          EP             T G L    + + DD  E F     D +++      I+FHKAHG +A++  T    P ++G +  +   G+V  F EKPK   G  IN G ++LNP+V+D I+   T+ E+E    +A +G+L A   PGFW
Sbjct:    1 MKAVILAGGLGTRLSEETIVKPKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEYFANYFLHMSDVTFHMAENRMEVHHKRVEPWNVTLVDTGDSSMTGGRLKRVAEYVKDD--EAFLFTYGDGVADLDIKATIDFHKAHGKKATLTATF--PPGRFGAL--DIQAGQVRSFQEKPK-GDGAMINGGFFVLNPSVIDLIDNDATTWEQEPLMTLAQQGELMAFEHPGFW 230          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: RFBF_SALTY (Glucose-1-phosphate cytidylyltransferase OS=Salmonella typhimurium GN=rfbF PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.816e-22
Identity = 73/237 (30.80%), Postives = 113/237 (47.68%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQET---------EPLG-----------TAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGFW 801
            MKA+IL GG GTRL   T+  PKP+VE   KP++ H ++     G+ + ++   Y+  V+  +   +   +        E          EP             T G L    + + DD  E F     D +++      I+FHKAHG +A++  T    P ++G +  +   G+V  F EKPK   G  IN G ++LNP+V+D I+   T+ E+E    +A +G+L A   PGFW
Sbjct:    1 MKAVILAGGLGTRLSEETIVKPKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEYFANYFLHMSDVTFHMAENRMEVHHKRVEPWNVTLVDTGDSSMTGGRLKRVAEYVKDD--EAFLFTYGDGVADLDIKATIDFHKAHGKKATLTATF--PPGRFGAL--DIRAGQVRSFQEKPK-GDGAMINGGFFVLNPSVIDLIDNDATTWEQEPLMTLAQQGELMAFEHPGFW 230          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_METM5 (Bifunctional protein glmU OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0513 PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.816e-22
Identity = 78/230 (33.91%), Postives = 117/230 (50.87%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKL--FVGNKINAGIYLLNPAVLDRIELRPTSIEKEV-----FPKIALEGKLFAMVLPGFWMDIGQP 819
            M A+IL  G GTRL P+T S PKP++  A KP++ H IE ++   V ++ L + ++ E ++ +  E       KI    + + LGT   +  A++ + DD    F VLN DVI E    E++++      E ++ ++KVD P  +GV+       KV   +EKPK      N INAGIY L  +V   +E    S   E+       K+   GKL  + L G+W DIG P
Sbjct:    1 MDAIILCAGKGTRLHPITESRPKPMIPIAGKPILEHIIEKIEN-HVEKIYLVVGFEKEKIIEYFNE-----NPKIEYILQEKQLGTGHAVLTAKNFIKDD----FLVLNGDVIFEDSIDEILDY------ENAVALSKVDNPENFGVIELGYD-NKVINLLEKPKKEELTSNFINAGIYKLQNSVFGILENLVPSERGEIELTDALKKLIEIGKLHGVELNGYWNDIGHP 213          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_METM7 (Bifunctional protein glmU OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0329 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.803e-22
Identity = 78/230 (33.91%), Postives = 116/230 (50.43%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKL--FVGNKINAGIYLLNPAVLDRIELRPTSIEKEV-----FPKIALEGKLFAMVLPGFWMDIGQP 819
            M A+IL  G GTRL P+T S PKP++  A KP++ H IE ++   V ++ L + ++ E ++ + KE       KI    + + LGT   +  A++ + DD    F VLN D+I E    E++ +      E ++ ++KV  P  +GVV       K+   +EKPK      N INAGIY L   V D +E    S   E+       K+   GKL  + L G+W DIG P
Sbjct:    1 MDAIILCAGKGTRLYPITESRPKPMIPIAGKPILEHIIEKIENY-VEKIYLVVGFEKEKIIEYFKE-----NPKIEYILQEKQLGTGHAVLTAKNFIKDD----FLVLNGDIIFEDSIDEILVY------ENAVALSKVGHPENFGVVELGYD-NKIINLLEKPKKEELPSNLINAGIYKLQNNVFDILENLVPSERGEIELTDALKKLIENGKLHGIELNGYWNDIGHP 213          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_METJA (Bifunctional protein glmU OS=Methanocaldococcus jannaschii GN=glmU PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 5.310e-21
Identity = 72/228 (31.58%), Postives = 115/228 (50.44%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKE-----VFPKIALEGKLFAMVLPGFWMDIGQP 819
            M A+IL  G G RLRPLT + PKP++  A KP++ H IE ++ + V  + L + Y+ E ++++ K        KI   ++ E  GT   +  A+D + D+    F V+N D+I E    E +++  A      + V +V  P  +GVVV ++    +E   EKP+    N INAGIY  +  + + IE    S   E         +  E K+  + L G+W D+G+P
Sbjct:    1 MDAIILCAGKGERLRPLTENRPKPMIPIAGKPILQHIIEKVEDL-VDNIYLIVKYKKEKIVDYFKNHP-----KIKFLEQGEIDGTGQAVLTAKDYVDDE----FLVINGDIIFEDDLEEFLKYKYA------VAVKEVKNPENFGVVVLDDENNIIE-LQEKPENPKSNLINAGIYKFDKKIFELIEKTKISERGERELTDAIKHLIKEEKVKGIKLNGYWNDVGRP 211          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_METVS (Bifunctional protein glmU OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0399 PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 6.935e-21
Identity = 78/234 (33.33%), Postives = 119/234 (50.85%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKP------KLFVGNKINAGIYLLNPAVLDRIE-LRPT---SIE-KEVFPKIALEGKLFAMVLPGFWMDIGQP 819
            M A+IL  G GTRL P+T + PKP++  A KP++ H IE ++   V ++ L + ++ E ++++    E     KI    + + LGT   + +A++ +  D    F VLN DVI E    E + +  A G      ++KVD P  +GV+       KV   +EKP        F  N INAGIY L   V + +E L P+    IE  +   K+    KL+ + L G+W DIG+P
Sbjct:    1 MDAVILCAGSGTRLYPITENRPKPMIPIAGKPILEHIIEKIEN-HVEKIYLVVGFEKEKIIDYFYGNE-----KIEFIVQEKQLGTGHAVLMAKNYIKGD----FLVLNGDVIFESDILEFLNYENAVG------LSKVDNPENFGVIELGYD-NKVINLLEKPNEDEIKSKFTSNLINAGIYKLENFVFEILENLLPSERGEIELTDALKKLIESSKLYGIELNGYWNDIGRP 217          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_META3 (Bifunctional protein glmU OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_0642 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.001e-19
Identity = 71/231 (30.74%), Postives = 119/231 (51.52%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPM---ILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIE-LRPT---SIE-KEVFPKIALEGKLFAMVLPGFWMDIGQP 819
            M A+IL  G GTRL PLT ++PKP++     P+   I+++I+ L    V  + L + Y+ E+++N  K  +     KI   ++T+  GT   + +A++ +  D    F V+N D+I +     ++        +  I + +VD PS +GV+V +     +E   EKPK    N INAGIY     + D +E LRP+    +E  +   ++  E  +  + L G+W DIG+P
Sbjct:    1 MDAVILCAGKGTRLMPLTENIPKPMLPVGGAPILERIINKIDKL----VENIYLIVKYEKEIIINHFKNND-----KIKFIEQTDIDGTGYAVLMAKNHISGD----FLVINGDIIFDDDLTNIVN----DDVKNIITLNEVDNPSNFGVIVVDNQNNIIE-LQEKPKNPKSNLINAGIYKFENKIFDILETLRPSERGEVELTDAIKELIKENNIKGIKLNGYWNDIGKP 213          
The following BLAST results are available for this feature:
BLAST of FC929261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
MPG1_SULAC1.180e-2831.56Putative mannose-1-phosphate guanyltransferase OS=... [more]
YBB2_SCHPO6.702e-2434.30Probable mannose-1-phosphate guanyltransferase OS=... [more]
GLMU_METMP1.651e-2233.91Bifunctional protein glmU OS=Methanococcus maripal... [more]
RFBF_SALTI2.156e-2230.80Glucose-1-phosphate cytidylyltransferase OS=Salmon... [more]
RFBF_SALTY2.816e-2230.80Glucose-1-phosphate cytidylyltransferase OS=Salmon... [more]
GLMU_METM52.816e-2233.91Bifunctional protein glmU OS=Methanococcus maripal... [more]
GLMU_METM74.803e-2233.91Bifunctional protein glmU OS=Methanococcus maripal... [more]
GLMU_METJA5.310e-2131.58Bifunctional protein glmU OS=Methanocaldococcus ja... [more]
GLMU_METVS6.935e-2133.33Bifunctional protein glmU OS=Methanococcus vanniel... [more]
GLMU_META31.001e-1930.74Bifunctional protein glmU OS=Methanococcus aeolicu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DC11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DC11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929261 ID=FC929261|Name=FC929261|organism=Citrus clementina|type=EST|length=823bp
GCAAAGCAAAAGCGAAGCGCGCGAAGCTCGCCTCATCCGTTGACTGAGCT
GTCGGTCCCGAGTCACGACTCGCGACTCTTGTTTTTGAACTCAGTTGTTT
GCCGTTCGGATCCGGTCTTAATTAAAGGATAAAGCAGGCTCCGTATCACA
ATGAAGGCACTTATTCTTGTTGGAGGGTTCGGAACACGGTTGAGGCCGTT
GACGCTTAGTGTCCCTAAGCCACTTGTTGAATTTGCTAACAAACCCATGA
TCCTGCATCAGATAGAGGCCCTTAAGGCAGTTGGAGTGACTGAAGTAGTT
TTGGCTATTAACTACCAGCCAGAGGTGATGTTGAACTTTTTGAAGGAATT
TGAAGCAAAGCTTGGGATCAAGATCATCTGCTCACAAGAGACTGAGCCAC
TGGGCACTGCTGGTCCTCTGGCTCTGGCTAGAGACAAATTGATTGACGAT
ACTGGTGAGCCATTTTTCGTCCTTAACAGTGATGTTATTAGTGAGTACCC
ATTTGCAGAAATGATTGAATTCCACAAAGCACATGGAGGAGAGGCCTCCA
TCATGGTAACCAAGGTGGATGAGCCATCAAAATATGGTGTGGTGGTTACG
GAAGAGTCTACTGGAAAAGTTGAGAAATTCGTTGAGAAACCTAAATTATT
TGTTGGTAACAAAATTAATGCTGGAATTTATCTTTTGAACCCTGCGGTTC
TTGATCGCATTGAGCTGAGGCCCACCTCCATTGAGAAAGAGGTCTTTCCA
AAAATTGCTTTAGAAGGAAAGCTCTTCGCGATGGTTCTTCCAGGTTTCTG
GATGGACATTGGACAGCCGAGGG
back to top