FC929261

Overview
NameFC929261
Unique NameFC929261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length823
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12949 contig Ccv1_Contig12949:141..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACC1 (Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ATCC 10987) GN=glgC PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.161e-14
Identity = 70/241 (29.05%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAKLGIKIICSQETEP------LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-DRIELRPTSIE------KEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A++L GG G+RL  LT ++ KP V F  K  I+   +      G+  V +   YQP  + N++      + +   G   +     E        GTA  +    + L     E   +L+ D I +  +++M+++H     + SI V +V  DE S++G++ T E    VE F EKP+    N  + GIY+ N A+L + +E+   + E      K+V P +  EG KL A    G+W D+G
Sbjct:    9 AMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCANSGIETVGILTQYQPLELHNYIGIGNAWDLDRVSGGVTVLPPYAESSGVKWYTGTASAIYQNLNYLSQYEPEYVLILSGDHIYKMDYSKMLDYHIEKEADVSISVIEVPWDEASRFGIMNTNEEMEIVE-FEEKPQFPRSNLASMGIYIFNWAILKEYLEMDARNPESSNDFGKDVLPLLLDEGKKLMAYPFEGYWKDVG 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACAN (Glucose-1-phosphate adenylyltransferase OS=Bacillus anthracis GN=glgC PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.161e-14
Identity = 70/241 (29.05%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAKLGIKIICSQETEP------LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-DRIELRPTSIE------KEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A++L GG G+RL  LT ++ KP V F  K  I+   +      G+  V +   YQP  + N++      + +   G   +     E        GTA  +    + L     E   +L+ D I +  +++M+++H     + SI V +V  DE S++G++ T E    VE F EKP+    N  + GIY+ N A+L + +E+   + E      K+V P +  EG KL A    G+W D+G
Sbjct:    9 AMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCANSGIETVGILTQYQPLELHNYIGIGNAWDLDRVSGGVTVLPPYAESSGVKWYTGTASAIYQNLNYLSQYEPEYVLILSGDHIYKMDYSKMLDYHIEKEADVSISVIEVPWDEASRFGIMNTNEEMEIVE-FEEKPQFPRSNLASMGIYIFNWAILKEYLEMDARNPESSNDFGKDVLPLLLDEGKKLMAYPFEGYWKDVG 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_DESHD (Glucose-1-phosphate adenylyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=glgC PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.822e-14
Identity = 68/241 (28.22%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEA------KLGIKIIC-----SQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI----ELRPTS---IEKEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A++L GG G+RL  LT ++PKP V FA K  I+   +       +  V +   Y+P  +  ++    A        GI I+      +Q +   GTA  +    D +     E   +L+ D I +  + EM+  HK    E ++    V  +E S++GV+VT ++ G++ +F EKP     N  + G+Y+ N  VL       E  P S     K V P++  +G +L++ +  G+W D+G
Sbjct:    8 AMLLAGGQGSRLGCLTRNIPKPAVSFAGKYRIIDFSLSNCSNSNIDTVGVLTQYKPFALNTYINMGSAWDLNCLNGGIHILPPFVGEAQGSWYKGTANAIYQNMDFINFYNPEYILILSGDHIYQMDYYEMLSCHKQKHAEVTLSAIAVPWEEASRFGVMVT-DAGGRIIRFEEKPPRPESNLASMGVYIFNWDVLKEALLEDERDPQSDHDFGKNVLPRLLQQGRRLYSYLFHGYWRDVG 247          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_DESHY (Glucose-1-phosphate adenylyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=glgC PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.686e-14
Identity = 67/241 (27.80%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEA------KLGIKIIC-----SQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI----ELRPTS---IEKEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A++L GG G+RL  LT ++PKP V FA K  I+   +       +  V +   Y+P  +  ++    A        GI I+      +Q +   GTA  +    D +     E   +L+ D I +  + EM+ +HK    E ++    V  +E S++GV+VT ++ G++ +F EKP     N  + G+Y+    VL       E  P S     K V P++  +G +L++ +  G+W D+G
Sbjct:    8 AMLLAGGQGSRLGCLTRNIPKPAVSFAGKYRIIDFSLSNCSNSNIDTVGVLTQYKPFALNTYINMGSAWDLNCLNGGIHILPPFVGEAQGSWYKGTANAIYQNMDFINFYNPEYILILSGDHIYQMDYYEMLSYHKQKHAEVTLSAIAVPWEEASRFGVMVT-DAGGRIIRFEEKPPRPESNLASMGVYIFKWDVLKEALLEDEQDPQSDHDFGKNVLPRLLQQGRRLYSYLFHGYWRDVG 247          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACCR (Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31) GN=glgC PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.814e-14
Identity = 69/241 (28.63%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAKLGIKIICSQETEP------LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-DRIELRPTSIE------KEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A++L GG G+RL  LT ++ KP V F  K  I+   +      G+  V +   YQP  + N++      + +   G   +     E        GTA  +    + L     E   +L+ D I +  +++M+++H     + SI V +V  DE S++G++ T E    VE F EKP+    N  + GIY+ N ++L + +E+   + E      K+V P +  EG KL A    G+W D+G
Sbjct:    9 AMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCANSGIETVGILTQYQPLELHNYIGIGNAWDLDRVSGGVTVLPPYAESSGVKWYTGTASAIYQNLNYLSQYEPEYVLILSGDHIYKMDYSKMLDYHIEKESDVSISVIEVPWDEASRFGIMNTNEEMEIVE-FEEKPQFPRSNLASMGIYIFNWSILKEYLEMDARNPESSNDFGKDVLPLLLDEGKKLMAYPFEGYWKDVG 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACAH (Glucose-1-phosphate adenylyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=glgC PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.814e-14
Identity = 69/241 (28.63%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAKLGIKIICSQETEP------LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-DRIELRPTSIE------KEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A++L GG G+RL  LT ++ KP V F  K  I+   +      G+  V +   YQP  + N++      + +   G   +     E        GTA  +    + L     +   +L+ D I +  +++M+++H     + SI V +V  DE S++G++ T E    VE F EKP+    N  + GIY+ N A+L + +E+   + E      K+V P +  EG KL A    G+W D+G
Sbjct:    9 AMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCANSGIETVGILTQYQPLELHNYIGIGNAWDLDRVSGGVTVLPPYAESSGVKWYTGTASAIYQNLNYLSQYEPDYVLILSGDHIYKMDYSKMLDYHIEKEADVSISVIEVPWDEASRFGIMNTNEEMEIVE-FEEKPQFPRSNLASMGIYIFNWAILKEYLEMDARNPESSNDFGKDVLPLLLDEGKKLMAYPFEGYWKDVG 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_THEP1 (Glucose-1-phosphate adenylyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glgC PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.287e-14
Identity = 68/245 (27.76%), Postives = 113/245 (46.12%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANK-PMILHQIEALKAVGVTEVVLAINYQPEVMLNFL----------KEFEAKLGIKIICSQETE-PLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFH--KAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI----ELRPTS---IEKEVFPKIALE--GKLFAMVLPGFWMDIGQPR 822
            A+IL GG GTRL  LT  V KP + F  K  +I   +      G+  V +   Y+P V+   +          K+   ++    +   E++   GTA  +    + L ++  E   +L+ D +    + ++I++H  K   G  + M   ++E S++G+++T    GK+  F EKP     N  + GIY+ N   L ++    E  P S     K+V P+I  E  G L+A    G+W D+G  R
Sbjct:    6 AMILAGGQGTRLGVLTERVAKPAIPFGGKYRLIDFTLSNCVNSGIYRVGVLTQYRPHVLSKHIGIGRPWDLDRKDGGVEILPPYVGRHESDWYKGTANAVYQNLEFLEENDAELVLILSGDHVYAMNYNDLIDYHLLKEADGTIACMEVPIEEASRFGIMITNVD-GKIVDFEEKPAKPRSNLASLGIYVFNYEFLKKVLIEDENDPNSSHDFGKDVIPRILRENLGSLYAFRFDGYWRDVGTLR 249          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_FERNB (Glucose-1-phosphate adenylyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=glgC PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.287e-14
Identity = 66/239 (27.62%), Postives = 112/239 (46.86%), Query Frame = 1
Query:  160 LILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVM---LNFLKEFEAKL---GIKII--CSQETEPL---GTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASI--MVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPT-------SIEKEVFPKIALEGKLFAMVLPGFWMDIG 813
            LIL GG GTRL  LT  +PKP V+F  K  I+   +      G+  + +   Y+P ++   +   K ++      G+ I+   S  TE +   GTA  +    + + +   E   VL+ D I    ++E + +H + G  A+I  M   + E  ++G++VT +   K+ +F EKPK    N  + GIY+     +  + +  +          K + PKI   GK++A    G+W D+G
Sbjct:    7 LILAGGQGTRLGVLTEKIPKPAVQFGGKYRIIDFTLSNCVNSGIYRIGVLTQYRPHLLNKHIGIGKPWDLDRKGGGVTILQPYSTLTESVWYKGTADAVYQNIEFVDEYNPEYIVVLSGDHIYSMDYSEFVYYHISKGALATIACMEVPITEAHRFGIMVT-DIENKIIEFQEKPKNPKSNLASLGIYVFTWNFIKEVLIEDSKDNSSDHDFGKNIIPKILSTGKVYAYPFEGYWQDVG 244          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_THESQ (Glucose-1-phosphate adenylyltransferase OS=Thermotoga sp. (strain RQ2) GN=glgC PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.211e-14
Identity = 67/245 (27.35%), Postives = 114/245 (46.53%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANK-PMILHQIEALKAVGVTEVVLAINYQPEVMLNFL----------KEFEAKLGIKIICSQETE-PLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFH--KAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI----ELRPTS---IEKEVFPKIALE--GKLFAMVLPGFWMDIGQPR 822
            A+IL GG GTRL  LT  + KP V F  K  +I   +      G+  V +   Y+P V+   +          K+   ++    +   E++   GTA  +    + L ++  E   +L+ D +    + ++I++H  K   G  + M   ++E S++G+++T+   G++  F EKP     N  + GIY+ N   L ++    E  P S     K+V P+I  E  G L+A    G+W D+G  R
Sbjct:    6 AMILAGGQGTRLGVLTERIAKPAVPFGGKYRLIDFTLSNCVNSGIYRVGVLTQYRPHVLSKHIGIGRPWDLDRKDGGVEILPPYVGRHESDWYKGTANAVYQNLEFLEENDAELVLILSGDHVYAMNYNDLIDYHLLKEADGTIACMEVPIEEASRFGIMITDVD-GRIVDFEEKPAKPRSNLASLGIYVFNYEFLKKVLIEDENDPNSSHDFGKDVIPRILRENLGSLYAFRFDGYWRDVGTLR 249          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_THEMA (Glucose-1-phosphate adenylyltransferase OS=Thermotoga maritima GN=glgC PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.211e-14
Identity = 67/245 (27.35%), Postives = 114/245 (46.53%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANK-PMILHQIEALKAVGVTEVVLAINYQPEVMLNFL----------KEFEAKLGIKIICSQETE-PLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFH--KAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI----ELRPTS---IEKEVFPKIALE--GKLFAMVLPGFWMDIGQPR 822
            A+IL GG GTRL  LT  + KP V F  K  +I   +      G+  V +   Y+P V+   +          K+   ++    +   E++   GTA  +    + L ++  E   +L+ D +    + ++I++H  K   G  + M   ++E S++G+++T+   G++  F EKP     N  + GIY+ N   L ++    E  P S     K+V P+I  E  G L+A    G+W D+G  R
Sbjct:    6 AMILAGGQGTRLGVLTERIAKPAVPFGGKYRLIDFTLSNCVNSGIYRVGVLTQYRPHVLSKHIGIGRPWDLDRKDGGVEILPPYVGRHESDWYKGTANAVYQNLEFLEENDAELVLILSGDHVYAMNYNDLIDYHLLKEADGTIACMEVPIEEASRFGIMITDVD-GRIVDFEEKPAKPRSNLASLGIYVFNYEFLKKVLIEDENDPNSSHDFGKDVIPRILRENLGSLYAFRFDGYWRDVGTLR 249          
The following BLAST results are available for this feature:
BLAST of FC929261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
GLGC_BACC12.161e-1429.05Glucose-1-phosphate adenylyltransferase OS=Bacillu... [more]
GLGC_BACAN2.161e-1429.05Glucose-1-phosphate adenylyltransferase OS=Bacillu... [more]
GLGC_DESHD2.822e-1428.22Glucose-1-phosphate adenylyltransferase OS=Desulfi... [more]
GLGC_DESHY3.686e-1427.80Glucose-1-phosphate adenylyltransferase OS=Desulfi... [more]
GLGC_BACCR4.814e-1428.63Glucose-1-phosphate adenylyltransferase OS=Bacillu... [more]
GLGC_BACAH4.814e-1428.63Glucose-1-phosphate adenylyltransferase OS=Bacillu... [more]
GLGC_THEP16.287e-1427.76Glucose-1-phosphate adenylyltransferase OS=Thermot... [more]
GLGC_FERNB6.287e-1427.62Glucose-1-phosphate adenylyltransferase OS=Fervido... [more]
GLGC_THESQ8.211e-1427.35Glucose-1-phosphate adenylyltransferase OS=Thermot... [more]
GLGC_THEMA8.211e-1427.35Glucose-1-phosphate adenylyltransferase OS=Thermot... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DC11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DC11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929261 ID=FC929261|Name=FC929261|organism=Citrus clementina|type=EST|length=823bp
GCAAAGCAAAAGCGAAGCGCGCGAAGCTCGCCTCATCCGTTGACTGAGCT
GTCGGTCCCGAGTCACGACTCGCGACTCTTGTTTTTGAACTCAGTTGTTT
GCCGTTCGGATCCGGTCTTAATTAAAGGATAAAGCAGGCTCCGTATCACA
ATGAAGGCACTTATTCTTGTTGGAGGGTTCGGAACACGGTTGAGGCCGTT
GACGCTTAGTGTCCCTAAGCCACTTGTTGAATTTGCTAACAAACCCATGA
TCCTGCATCAGATAGAGGCCCTTAAGGCAGTTGGAGTGACTGAAGTAGTT
TTGGCTATTAACTACCAGCCAGAGGTGATGTTGAACTTTTTGAAGGAATT
TGAAGCAAAGCTTGGGATCAAGATCATCTGCTCACAAGAGACTGAGCCAC
TGGGCACTGCTGGTCCTCTGGCTCTGGCTAGAGACAAATTGATTGACGAT
ACTGGTGAGCCATTTTTCGTCCTTAACAGTGATGTTATTAGTGAGTACCC
ATTTGCAGAAATGATTGAATTCCACAAAGCACATGGAGGAGAGGCCTCCA
TCATGGTAACCAAGGTGGATGAGCCATCAAAATATGGTGTGGTGGTTACG
GAAGAGTCTACTGGAAAAGTTGAGAAATTCGTTGAGAAACCTAAATTATT
TGTTGGTAACAAAATTAATGCTGGAATTTATCTTTTGAACCCTGCGGTTC
TTGATCGCATTGAGCTGAGGCCCACCTCCATTGAGAAAGAGGTCTTTCCA
AAAATTGCTTTAGAAGGAAAGCTCTTCGCGATGGTTCTTCCAGGTTTCTG
GATGGACATTGGACAGCCGAGGG
back to top