FC929261

Overview
NameFC929261
Unique NameFC929261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length823
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12949 contig Ccv1_Contig12949:141..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_OCEIH (Bifunctional protein glmU OS=Oceanobacillus iheyensis GN=glmU PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.072e-13
Identity = 57/187 (30.48%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVL-NSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNK----INAGIYLLNPAVL 702
            A+IL  G GTR++     + K L   A +PM+ H ++ L+ V + ++V  + +  E       + +A+LG     + + E LGT   +  A D L D+ G       ++ +I    F E+I++HK  G +ASI+ TKV+ P+ YG VV  +   +VE+ VE      G +    IN G Y  +   L
Sbjct:    6 AVILAAGQGTRMKS---KLHKMLHPVAGRPMVQHVVDQLQQVNLNKIVTIVGFGAE-------KVKAQLGSSSEFAFQKEQLGTGHAVLQAEDLLKDEKGVTVVACGDTPLIRAETFEELIQYHKKTGAKASILTTKVENPTGYGRVVRNDQ-DEVERIVEHKDANEGERLIQEINTGTYCFDNQAL 181          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_THEAB (Glucose-1-phosphate adenylyltransferase OS=Thermosipho africanus (strain TCF52B) GN=glgC PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.072e-13
Identity = 63/240 (26.25%), Postives = 113/240 (47.08%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANK-PMILHQIEALKAVGVTEVVLAINYQPEVM---LNFLKEFEAKL---GIKIICSQETEPL-----GTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASI--MVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIE-------KEVFPKIALEGKLFAMVLPGFWMDIG 813
            ALIL GG GTRL  LT  + KP V+F  K  +I   +      G+ ++ +   Y+P ++   +   K ++      G+ I+    TE       GTA  +    + + D   E   +L+ D I    + E++++HKA    A++  M   + E S++G++VT +   ++ +F EKPK       + GIY+   + +  + +     +       K++ PKI    ++FA    G+W D+G
Sbjct:    6 ALILAGGQGTRLGVLTEKIAKPAVQFGGKYRLIDFTLSNCVNSGIYKIGVLTQYKPHLLNQHIGIGKPWDLDRKDGGVTILQPYYTEKKGVWYNGTADAVYRNIEFVDDYNPEYVVILSGDHIYSMDYNELLDYHKAKSALATVACMEVPLSEASRFGIMVT-DLENRIIEFQEKPKQPKSTLASLGIYVFQWSFIREVLIEDAKNDQSSHDFGKDIIPKIIQTERVFAFPFDGYWKDVG 244          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACCL (Glucose-1-phosphate adenylyltransferase (Fragment) OS=Bacillus caldolyticus GN=glgC PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.389e-13
Identity = 67/248 (27.02%), Postives = 114/248 (45.97%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNF------------------LKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLN-PAVLDRIEL------RPTSIEKEVFPKIALEGK-LFAMVLPGFWMDIG 813
            A++L GG G+RLR LT ++ KP V F  K  I+   +      G+  V +   YQP ++ ++                  L  + A  G+K          GTA  +    + +     +   VL+ D I +  + +M+++H A   +A+I V +V  +E S++G++ T E+   VE F EKP     N  + GIY+ N P + + +++            K+V P++  E K L A    G+W D+G
Sbjct:    7 AMLLAGGQGSRLRSLTKNIAKPAVPFGGKYRIIDFTLSNCTNSGIDTVGVLTQYQPLLLHSYIGIGSAWDLDRRNGGVTVLPPYSASSGVKWY-------EGTANAIYQNMNYIEQYDPDYVLVLSGDHIYKMDYQQMLDYHIAKQADATISVIEVPWEEASRFGIMNTNENMEIVE-FAEKPANPKSNLASMGIYIFNWPLLREYLQIDNADPHSSHDFGKDVIPRLLRENKRLVAYPFKGYWKDVG 246          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_CLOD6 (Bifunctional protein glmU OS=Clostridium difficile (strain 630) GN=glmU PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.075e-13
Identity = 51/186 (27.42%), Postives = 94/186 (50.54%), Query Frame = 1
Query:  145 ITMKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNK----INAGIYLLN 690
            +  KA+IL  G GTR++      PK + +   K M+ H I+  K  GV + V+ + ++ +V+       + KL  +II + +TE LGT   + +A++ + D+        ++ +I E     + E+H  +   A+++ T+V  P+ YG ++ ++  G + K VE+       K    IN+GIY  N
Sbjct:    1 MNFKAIILAAGKGTRMKS---KYPKVIHKVCGKEMVNHIIDVSKKSGVKDTVVILGHEADVV-------KEKLAEEIIIAMQTEQLGTGHAVKMAKEYINDEDTIVVLCGDTPLIKEETLKRLFEYHIENKYHATVLTTRVGNPTGYGRIIRDKK-GDLLKIVEQKDANSEEKMISEINSGIYCFN 175          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_MYCMO (Glucose-1-phosphate adenylyltransferase OS=Mycoplasma mobile GN=glgC PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.075e-13
Identity = 66/246 (26.83%), Postives = 115/246 (46.75%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKL---------GIKIICSQETEP-----LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL----DRIELRPTSIE---KEVFPKIALE-GKLFAMVLPGFWMDIG 813
            M A+IL GG GTRL+ LT  + KP V F  K  I+   +      G+  V +   Y+P   L+ LK   + +         G+ ++     E       GTA  +    D + +       +L+ D I +  +++M++FHK      +I    V  +E S++G++ T E+   VE+F EKPK+    K + G+Y+ N  +L    + ++ +  + +     + P I  +  K+FA    G+W D+G
Sbjct:    6 MIAMILAGGQGTRLKNLTKKIAKPAVPFGAKYRIIDFTLSNCINSGIDTVGVLTQYRP---LSLLKHIGSGIPFDLNRLNGGVVLLSPYVKESEGYWYAGTAHAIFENIDFMNEYDPTYALILSGDHIYKMDYSKMLDFHKEKNANVTIATINVSFEEASRFGILNTNEN-NMVEEFEEKPKIPKSTKASMGVYIFNYQLLKDTFEELKSKGNNFQDFGHNILPYILKKYSKIFAYEFNGYWKDVG 247          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: Y1334_METJA (Putative UTP--glucose-1-phosphate uridylyltransferase OS=Methanocaldococcus jannaschii GN=MJ1334 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.322e-13
Identity = 63/221 (28.51%), Postives = 108/221 (48.87%), Query Frame = 1
Query:  154 KALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLA-------------INYQPEV---------MLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFV--LNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEE---STGKVEKFVEKPKL--FVGNKINAGIYLLNPAVLDRIELRP 723
            KA+I V GFGTRL P+T + PK ++   NKP++ + +E L   GV +++               +NY+ E          +L  +KE +    I  +  +E + LG A    L  ++ +   GE +F+  +   + S+    ++I+ H+ +G    I + +V  ++  KYGV+  EE      K++  VEKPK+     N I  G YLL+P + ++I   P
Sbjct:    4 KAVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVEAGVKDILFVTGKGKQAIENHFDVNYELECKLEKSGKYELLKIIKEIDRLGNIFYVRQKEQKGLGDA---ILYGEEFV---GEEYFIAMVGDTIYSKNIVKDLIKAHEKYGCSV-IALERVPKEDVYKYGVIDGEEIEKGVYKIKNMVEKPKVEEAPSNLIITGAYLLSPKIFEKIRETP 217          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_CLOAB (Glucose-1-phosphate adenylyltransferase OS=Clostridium acetobutylicum GN=glgC PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.951e-13
Identity = 66/241 (27.39%), Postives = 108/241 (44.81%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFL------KEFEAKLGIKIICSQETEP-----LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI-------ELRPTSIEKEVFPK-IALEGKLFAMVLPGFWMDIG 813
            A+IL GG G+RL  LT    KP V F  K  I+   +      G+  V +   Y+P  + + +             G+ ++     E       GTA  +   R  + +   E   +L+ D I +  + EM++FHK    +A+I V +V  +E S++G++ T+E   ++ +F EKPK    N  + GIY+ N   L R        E       K + P  +  + KL+A    G+W D+G
Sbjct:    8 AMILAGGQGSRLGILTRRTAKPAVPFGGKYRIIDFTLSNCSNSGIDTVGVLTQYKPLALNSHIGIGSPWDLDRTSGGVSVLPPYMKETGGNWYKGTANAIYQNRHFIENYDPEYVVILSGDHIYKMNYLEMLDFHKKKNADATIAVFEVPLNEASRFGIMNTDED-DRINEFEEKPKKPKNNLASMGIYIFNWRFLKRFLEEDARDESSNNDFGKNIIPNMLNKKRKLYAYRFNGYWKDVG 247          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACLD (Glucose-1-phosphate adenylyltransferase OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=glgC PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 9.079e-13
Identity = 68/244 (27.87%), Postives = 113/244 (46.31%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEA------KLGIKII-----CSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVD--EPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAV----LDRIELRPTS---IEKEVFPKIALEGK-LFAMVLPGFWMDIGQPR 822
            A++L GG G+RL  LT ++ KP V F  K  I+   +      G+  V +   YQP ++ +++   E         G+ I+      S+     GTA  +   R  L +   E   +L+ D I +  + +M+E+H     +A+I V +V   E  ++G++ T +   ++  F EKPK    N  + G+Y+   +V    L+R E    S     K+V P +  E K L A    G+W D+G  R
Sbjct:    7 AMLLAGGKGSRLNALTKNLAKPAVPFGGKYRIIDFALSNCANSGIHHVGVLTQYQPLLLNSYIGIGEPWDLDRNDGGVSILSPYAEASEVKWYKGTASAIYENRHFLKELQPEHVLILSGDHIYKMDYGKMLEYHAEKQADATIAVIEVSWAEAGRFGILHTNDKM-EITSFEEKPKYPKSNLASMGVYVFKWSVLEDALERDEKNSASSHDFGKDVIPALLEENKRLNAYPFKGYWKDVGTVR 249          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_CARHZ (Bifunctional protein glmU OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=glmU PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.186e-12
Identity = 65/219 (29.68%), Postives = 101/219 (46.12%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNK----INAGIYLLNPAVLDRI--ELRPTSIEKE-----VFPKIALEGKL 774
            M+ +IL  G GTR++     +PK + E A KPM+L   EAL   GV  VV  + Y+ E +   L+      G  +I  QE E LGT G  AL     ++D        ++ ++       +I+ H   G  A+++   +  P  YG +V  +  GK+ K VE+    +  K    +N GIY  N  +L  I   L+  + +KE     V P +   GK+
Sbjct:    1 MEGIILAAGKGTRMKS---DLPKVVHEVAEKPMVLRVYEALVGAGVKRVVAVVGYRKEKVEEILR------GRAVIAVQE-EQLGT-GHAALVAMPYVEDENVIIVPGDTPLLKASTLQALIKKHLETGAYATVLTCFLSNPYGYGRIV-RDGYGKIIKIVEEKDATLEEKQIAEVNTGIYCFNTKILKEILPLLKAENAQKEYYLTDVIPLLLERGKV 207          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: RMLA_SALAN (Glucose-1-phosphate thymidylyltransferase OS=Salmonella anatum GN=rmlA PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.022e-12
Identity = 60/229 (26.20%), Postives = 112/229 (48.91%), Query Frame = 1
Query:  148 TMKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIE-LRPTS---IEKEVFPKIALE-GKL-FAMVLPGF-WMDIG 813
            T K +IL GG GTRL P+T++V K L+   +KPMI + +  L   G+ ++++    Q       L    ++ G+ +    +  P G A    +  + + +D  +   VL  ++   +   +++E        A++    V++P +YGVV  ++S G      EKP     N    G+Y  + +V++  + L+P++   +E     +I +E G+L  AM+  G+ W+D G
Sbjct:    3 TRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGND--DCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDQS-GTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTG 228          
The following BLAST results are available for this feature:
BLAST of FC929261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
GLMU_OCEIH1.072e-1330.48Bifunctional protein glmU OS=Oceanobacillus iheyen... [more]
GLGC_THEAB1.072e-1326.25Glucose-1-phosphate adenylyltransferase OS=Thermos... [more]
GLGC_BACCL2.389e-1327.02Glucose-1-phosphate adenylyltransferase (Fragment)... [more]
GLMU_CLOD64.075e-1327.42Bifunctional protein glmU OS=Clostridium difficile... [more]
GLGC_MYCMO4.075e-1326.83Glucose-1-phosphate adenylyltransferase OS=Mycopla... [more]
Y1334_METJA5.322e-1328.51Putative UTP--glucose-1-phosphate uridylyltransfer... [more]
GLGC_CLOAB6.951e-1327.39Glucose-1-phosphate adenylyltransferase OS=Clostri... [more]
GLGC_BACLD9.079e-1327.87Glucose-1-phosphate adenylyltransferase OS=Bacillu... [more]
GLMU_CARHZ1.186e-1229.68Bifunctional protein glmU OS=Carboxydothermus hydr... [more]
RMLA_SALAN2.022e-1226.20Glucose-1-phosphate thymidylyltransferase OS=Salmo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DC11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DC11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929261 ID=FC929261|Name=FC929261|organism=Citrus clementina|type=EST|length=823bp
GCAAAGCAAAAGCGAAGCGCGCGAAGCTCGCCTCATCCGTTGACTGAGCT
GTCGGTCCCGAGTCACGACTCGCGACTCTTGTTTTTGAACTCAGTTGTTT
GCCGTTCGGATCCGGTCTTAATTAAAGGATAAAGCAGGCTCCGTATCACA
ATGAAGGCACTTATTCTTGTTGGAGGGTTCGGAACACGGTTGAGGCCGTT
GACGCTTAGTGTCCCTAAGCCACTTGTTGAATTTGCTAACAAACCCATGA
TCCTGCATCAGATAGAGGCCCTTAAGGCAGTTGGAGTGACTGAAGTAGTT
TTGGCTATTAACTACCAGCCAGAGGTGATGTTGAACTTTTTGAAGGAATT
TGAAGCAAAGCTTGGGATCAAGATCATCTGCTCACAAGAGACTGAGCCAC
TGGGCACTGCTGGTCCTCTGGCTCTGGCTAGAGACAAATTGATTGACGAT
ACTGGTGAGCCATTTTTCGTCCTTAACAGTGATGTTATTAGTGAGTACCC
ATTTGCAGAAATGATTGAATTCCACAAAGCACATGGAGGAGAGGCCTCCA
TCATGGTAACCAAGGTGGATGAGCCATCAAAATATGGTGTGGTGGTTACG
GAAGAGTCTACTGGAAAAGTTGAGAAATTCGTTGAGAAACCTAAATTATT
TGTTGGTAACAAAATTAATGCTGGAATTTATCTTTTGAACCCTGCGGTTC
TTGATCGCATTGAGCTGAGGCCCACCTCCATTGAGAAAGAGGTCTTTCCA
AAAATTGCTTTAGAAGGAAAGCTCTTCGCGATGGTTCTTCCAGGTTTCTG
GATGGACATTGGACAGCCGAGGG
back to top