FC929261

Overview
NameFC929261
Unique NameFC929261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length823
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12949 contig Ccv1_Contig12949:141..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: RMLA_SALTY (Glucose-1-phosphate thymidylyltransferase OS=Salmonella typhimurium GN=rmlA PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.004e-11
Identity = 59/229 (25.76%), Postives = 110/229 (48.03%), Query Frame = 1
Query:  148 TMKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIE-LRPTS---IEKEVFPKIALE-GKL-FAMVLPGF-WMDIG 813
            T K +IL GG GTRL P+T++V K L+   +KPMI + +  L   G+ ++++    Q       L    ++ G+ +    +  P G A    +  + +  D  +   VL  ++   +   +++E        A++    V++P +YGVV  ++  G      EKP     N    G+Y  + +V++  + L+P++   +E     +I +E G+L  AM+  G+ W+D G
Sbjct:    3 TRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGHD--DCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDQK-GTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTG 228          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: RMLA_RHISN (Probable glucose-1-phosphate thymidylyltransferase OS=Rhizobium sp. (strain NGR234) GN=rmlA PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.004e-11
Identity = 64/231 (27.71%), Postives = 106/231 (45.89%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEP-FFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLD-RIELRPTS---IEKEVFPKIALE-GKLFAMVL-PGF-WMDIGQP 819
            MK +IL GG GTRL P+TL + K ++   +KPMI + +  L   G+ E+++        +   L    ++ GI +  + +  P G A    +  D +    G P   +L  ++   +    +++   A    A+I    V++P +YGVV  +E    +    EKP          G+Y  +  V+D    L+P++    E     +I LE GKL   VL  G+ W+D G P
Sbjct:    1 MKGIILAGGSGTRLHPMTLVMSKQILPVYDKPMIFYPLTTLMLAGIREILIISTPHHMPLFQALLGDGSQWGISLRYAVQPSPNGLAQAYVIGADFV---AGSPSCLILGDNIYFGHGLQGLLQQAAALQQGATIFAYHVNDPERYGVVEFDEGMNAL-SIEEKPAAPKSTWAVTGLYFYDSEVVDIAANLKPSARGEYEITDVNRIYLERGKLKVAVLGRGYAWLDTGTP 227          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: RMLA3_ECOLX (Glucose-1-phosphate thymidylyltransferase OS=Escherichia coli GN=rmlA PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.004e-11
Identity = 61/230 (26.52%), Postives = 109/230 (47.39%), Query Frame = 1
Query:  148 TMKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLD--RIELRPTS---IEKEVFPKIALE-GKL-FAMVLPGF-WMDIG 813
            T K +IL GG GTRL P+T++V K L+   +KPMI + +  L   G+ ++++    Q       L    ++ G+ +    +  P G A    +  D +  D  +   VL  ++   +   +++E        A++    V++P +YG VV  ++ G      EKP     N    G+Y  +  V++  R  L+P++   +E     +I +E G+L  AM+  G+ W+D G
Sbjct:    3 TRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEDFIGGD--DCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYG-VVEFDNNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVEMARKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTG 229          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACHD (Glucose-1-phosphate adenylyltransferase OS=Bacillus halodurans GN=glgC PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.004e-11
Identity = 64/240 (26.67%), Postives = 106/240 (44.17%), Query Frame = 1
Query:  160 LILVGGFGTRLRPLTLSVPKPLVEFANKPMILH-QIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAKLGIKIICSQETEPLG------TAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPT-------SIEKEVFPK-IALEGKLFAMVLPGFWMDIG 813
            ++L GG G RL  LT  + KP V F  K  I+   +      G+  V +   Y+P  +   +      + + + G   +     E  G      TA  +   R  +     E   +L+ D I +  +  MI  HK  G +A+I V +V  +E S++G++ T E    + +F EKP   + N  + GIY+ N +VL    ++            K++ PK +A + KL A    G+W D+G
Sbjct:    8 MLLAGGEGKRLGQLTRKLAKPAVYFGGKYRIIDFPLSNCTNSGIDTVGVLTQYEPLALNGHIGIGSPWDLDRRHGGVTVLPPYIEKQGGSWYKGTADAIYQNRYYIEQYDPEYVLILSGDHIYKMDYDRMISHHKKLGADATISVIEVPWEEASRFGIMNTNEEM-TITQFEEKPTTPISNLASMGIYIFNWSVLKSYLIQDAKQANSSHDFGKDIIPKMLAKDLKLVAYPFEGYWKDVG 246          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_PELPD (Bifunctional protein glmU OS=Pelobacter propionicus (strain DSM 2379) GN=glmU PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.311e-11
Identity = 51/187 (27.27%), Postives = 94/187 (50.27%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVL-NSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEK----PKLFVGNKINAGIYLLNPAVL 702
            A+IL  G GTR++   + V  P+   A +PMI   +EA +  G   VVL + +Q E +    + F+      I C+ + E LGT   +A A   L   +G    +  ++ ++      +++ FH++ G   +++  +++ P  YG V+ +E+ G+V + VE+    P+     +IN+GIY +    L
Sbjct:    6 AIILAAGKGTRMKSGLVKVLHPI---AGRPMIDWPLEAARGAGAAPVVLVVGHQAEAV---RERFQG--AGDIACALQAEQLGTGHAVACAAPALAGFSGTVLILCGDTPLLRGGTLTDLLAFHRSQGAAVTVLTARMENPHGYGRVLRDEA-GRVLRIVEQKDASPQECSVREINSGIYCMEAGFL 183          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_DESRM (Bifunctional protein glmU OS=Desulfotomaculum reducens (strain MI-1) GN=glmU PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.311e-11
Identity = 53/206 (25.73%), Postives = 103/206 (50.00%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVL-NSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEK----PKLFVGNKINAGIYLLN-PAVLDRI-ELRPTSIEKEVF 747
            + A+IL  G GTR++    ++PK L +   +PM+ H + ++ A GV + V+   +  E + +F       +G K     + E LGTA  L  A  +L D  G    V  ++ ++     A++ ++H   G  A+++  ++ +P+ YG V+   + G V   VE+    P+    ++IN G+Y    P + + + E+ P +++ E +
Sbjct:    3 LAAVILAAGKGTRMKS---NLPKVLHQLCGRPMLSHVLNSVVAAGVDKTVVVAGFGAEQVTDF-------VGEKARVVLQREQLGTAHALLQAEGELTDYPGHLLVVCGDTPLLRAETLAKLADYHCESGAVATLLTAEMADPTGYGRVI-RTTEGNVSHIVEQKDASPEELNVHEINTGVYCFKVPGLFNALKEISPANVQGEYY 197          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: EI2BG_RAT (Translation initiation factor eIF-2B subunit gamma OS=Rattus norvegicus GN=Eif2b3 PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 1.311e-11
Identity = 42/143 (29.37%), Postives = 75/143 (52.45%), Query Frame = 1
Query:  154 KALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSK 582
            +A+++  G G+R+  LT S+PKPL+   NKP+I + +  L+ VG  EV++      +V      EF+ KL   I+C  +   +GTA  L     KL  D      VL  D+I++    E+++  +A+    ++++ K  E ++
Sbjct:    4 QAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTT--KDVQKALCAEFKMKLKPDIVCIPDEADMGTADSLRHIYPKLKTDV----LVLGCDLITDVALHEVVDLFRAYDASLAMLMRKGQESTE 140          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_THELT (Glucose-1-phosphate adenylyltransferase OS=Thermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / TMO) GN=glgC PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.236e-11
Identity = 65/245 (26.53%), Postives = 114/245 (46.53%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANK-PMILHQIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAKLGIKIICSQETEPL-----GTAGPLALARDKLIDDTGEPFFV--LNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEK-------EVFPKIALEG-KLFAMVLPGFWMDIGQPR 822
            ALIL GG G RL  LT  + KP V F  K  +I   +      G+  V +   Y+P ++ N +      + + K G   I       +     GTA   A+ ++    D+ +P FV  L+ D +    + ++I+FH   G E +I   +V  +E +++G+++T+  + ++  F EKP+    N  + GIY+ N   L    +R     +       ++ P +  EG +++A    G+W D+G  R
Sbjct:    6 ALILAGGHGKRLGVLTEKIAKPAVPFGGKYRLIDFTLSNCVNSGIYHVGVLTQYRPHLLNNHINIGRPWDLDRKKGGVTILPPYLGGVAGWYRGTAN--AVYQNIEYVDSADPDFVLILSGDHVYAMDYNDIIDFHILKGAEGTIACIEVPPEETNRFGIMMTDLDS-RIVDFEEKPQRARSNLASLGIYVFNWKFLKEYLIRDEQNNESTHDFGHDIIPLMINEGCQIYAFKFNGYWRDVGTVR 247          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_STRR6 (Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glgC PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.236e-11
Identity = 60/243 (24.69%), Postives = 108/243 (44.44%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEA------KLGIKIICSQETEP-----LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLN-------PAVLDRIELRPTSIEKEVFPKIALEGK-LFAMVLPGFWMDIG 813
            M ALIL GG GTRL  LT S+ KP V+F  +  I+   +      G+  V +   YQP  + N +    +        G+ I+             GT+  +    D + +   E   +L+ D I +  + +M++ HK +    ++ V  V   E S++G++ T ++  ++ +F EKP      K + GIY+ +           ++ ++  +   K V P     G+ ++A    G+W D+G
Sbjct:    5 MLALILAGGQGTRLGKLTQSIAKPAVQFGGRYRIIDFALSNCANSGIHNVGVVTQYQPLALNNHIGNGSSWGLDGINSGVSILQPYSASEGNRWFEGTSHAIYQNIDYIDNVNPEYVLILSGDHIYKMDYDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNT-DANNRIVEFEEKPAQPKSTKASMGIYIFDWQRLRNMLVAAEKSKVGMSDFGKNVIPNYLESGESVYAYEFSGYWKDVG 246          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_STRP2 (Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glgC PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.236e-11
Identity = 60/243 (24.69%), Postives = 108/243 (44.44%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEA------KLGIKIICSQETEP-----LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLN-------PAVLDRIELRPTSIEKEVFPKIALEGK-LFAMVLPGFWMDIG 813
            M ALIL GG GTRL  LT S+ KP V+F  +  I+   +      G+  V +   YQP  + N +    +        G+ I+             GT+  +    D + +   E   +L+ D I +  + +M++ HK +    ++ V  V   E S++G++ T ++  ++ +F EKP      K + GIY+ +           ++ ++  +   K V P     G+ ++A    G+W D+G
Sbjct:    5 MLALILAGGQGTRLGKLTQSIAKPAVQFGGRYRIIDFALSNCANSGIHNVGVVTQYQPLALNNHIGNGSSWGLDGINSGVSILQPYSASEGNRWFEGTSHAIYQNIDYIDNVNPEYVLILSGDHIYKMDYDDMLQSHKDNNASLTVAVLDVPLKEASRFGIMNT-DANNRIVEFEEKPAQPKSTKASMGIYIFDWQRLRNMLVAAEKSKVGMSDFGKNVIPNYLESGESVYAYEFSGYWKDVG 246          
The following BLAST results are available for this feature:
BLAST of FC929261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
RMLA_SALTY1.004e-1125.76Glucose-1-phosphate thymidylyltransferase OS=Salmo... [more]
RMLA_RHISN1.004e-1127.71Probable glucose-1-phosphate thymidylyltransferase... [more]
RMLA3_ECOLX1.004e-1126.52Glucose-1-phosphate thymidylyltransferase OS=Esche... [more]
GLGC_BACHD1.004e-1126.67Glucose-1-phosphate adenylyltransferase OS=Bacillu... [more]
GLMU_PELPD1.311e-1127.27Bifunctional protein glmU OS=Pelobacter propionicu... [more]
GLMU_DESRM1.311e-1125.73Bifunctional protein glmU OS=Desulfotomaculum redu... [more]
EI2BG_RAT1.311e-1129.37Translation initiation factor eIF-2B subunit gamma... [more]
GLGC_THELT2.236e-1126.53Glucose-1-phosphate adenylyltransferase OS=Thermot... [more]
GLGC_STRR62.236e-1124.69Glucose-1-phosphate adenylyltransferase OS=Strepto... [more]
GLGC_STRP22.236e-1124.69Glucose-1-phosphate adenylyltransferase OS=Strepto... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DC11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DC11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929261 ID=FC929261|Name=FC929261|organism=Citrus clementina|type=EST|length=823bp
GCAAAGCAAAAGCGAAGCGCGCGAAGCTCGCCTCATCCGTTGACTGAGCT
GTCGGTCCCGAGTCACGACTCGCGACTCTTGTTTTTGAACTCAGTTGTTT
GCCGTTCGGATCCGGTCTTAATTAAAGGATAAAGCAGGCTCCGTATCACA
ATGAAGGCACTTATTCTTGTTGGAGGGTTCGGAACACGGTTGAGGCCGTT
GACGCTTAGTGTCCCTAAGCCACTTGTTGAATTTGCTAACAAACCCATGA
TCCTGCATCAGATAGAGGCCCTTAAGGCAGTTGGAGTGACTGAAGTAGTT
TTGGCTATTAACTACCAGCCAGAGGTGATGTTGAACTTTTTGAAGGAATT
TGAAGCAAAGCTTGGGATCAAGATCATCTGCTCACAAGAGACTGAGCCAC
TGGGCACTGCTGGTCCTCTGGCTCTGGCTAGAGACAAATTGATTGACGAT
ACTGGTGAGCCATTTTTCGTCCTTAACAGTGATGTTATTAGTGAGTACCC
ATTTGCAGAAATGATTGAATTCCACAAAGCACATGGAGGAGAGGCCTCCA
TCATGGTAACCAAGGTGGATGAGCCATCAAAATATGGTGTGGTGGTTACG
GAAGAGTCTACTGGAAAAGTTGAGAAATTCGTTGAGAAACCTAAATTATT
TGTTGGTAACAAAATTAATGCTGGAATTTATCTTTTGAACCCTGCGGTTC
TTGATCGCATTGAGCTGAGGCCCACCTCCATTGAGAAAGAGGTCTTTCCA
AAAATTGCTTTAGAAGGAAAGCTCTTCGCGATGGTTCTTCCAGGTTTCTG
GATGGACATTGGACAGCCGAGGG
back to top