FC929277

Overview
NameFC929277
Unique NameFC929277
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length892
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9258 contig Ccv1_Contig9258:11..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP124_ARATH (Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.647e-11
Identity = 41/158 (25.95%), Postives = 75/158 (47.47%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDL 480
            R  G+  D   Y T +      G   EA  +FRT+       D+ +YS L++   K  RL+   +L   +  G  + D+ +YN+++ A    G + +A  +F  M+A G  P+   ++ L+    ++     V +L   M   N  PDA+T +I++++
Sbjct:  239 RHEGIQPDIVTYNTLLSACAIRGLGDEAEMVFRTMNDGGIVPDLTTYSHLVETFGKLRRLEKVCDLLGEMASGGSLPDITSYNVLLEAYAKSGSIKEAMGVFHQMQAAGCTPNANTYSVLLNLFGQSGRYDDVRQLFLEMKSSNTDPDAATYNILIEV 396          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR81_ARATH (Pentatricopeptide repeat-containing protein At1g55630 OS=Arabidopsis thaliana GN=At1g55630 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.375e-11
Identity = 40/158 (25.32%), Postives = 74/158 (46.84%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            + G + D + Y   +  L      + AL L   +R +  E  +  ++ LIDGL ++G+L+          +     DVV Y +MI    + G+++KA ++F +M  KG  P+   +N+++ G     +  +   LL  M+ R   P+    S +V+ L
Sbjct:  285 KDGFSPDLYTYNILLHHLATGNKPLAALNLLNHMREVGVEPGVIHFTTLIDGLSRAGKLEACKYFMDETVKVGCTPDVVCYTVMITGYISGGELEKAEEMFKEMTEKGQLPNVFTYNSMIRGFCMAGKFKEACALLKEMESRGCNPNFVVYSTLVNNL 442          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP297_ARATH (Pentatricopeptide repeat-containing protein At4g01030, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H65 PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 7.375e-11
Identity = 43/152 (28.29%), Postives = 77/152 (50.66%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            D +   T ID   K GY+  A  +F  +       +I +++ L+ GL  +  LK A  L   + +  +  D +T+N +       GK +KA D+   M+ KGVAP+ V++  +  GC +N      +++  +M E  V P+A+T+S ++ +L
Sbjct:  259 DVYVETTLIDMYIKTGYLPYARMVFDMMDAK----NIVAWNSLVSGLSYACLLKDAEALMIRMEKEGIKPDAITWNSLASGYATLGKPEKALDVIGKMKEKGVAPNVVSWTAIFSGCSKNGNFRNALKVFIKMQEEGVGPNAATMSTLLKIL 406          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP196_ARATH (Pentatricopeptide repeat-containing protein At2g40240, mitochondrial OS=Arabidopsis thaliana GN=At2g40240 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.375e-11
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 1
Query:   37 AYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            AY   I  LCK G I +AL +   +   +  L   +Y  ++  L +  +++ AW +  S+    +  DV  YN  + + C DG+++ A ++   +E  G +PD  +++ L+LG  R  +    + +L RM+E  V    ST + V+  LV+
Sbjct:  109 AYDILISRLCKLGRIDDALIVIGDMSNGRLGLTPSTYHPILCSLTRKYKIEEAWRVVESMRSKSVSMDVTAYNYFLTSHCYDGELESASEVMRKIEEDGNSPDSRSYDALVLGACRAGKVEAAMAILRRMEEDGVTVLYSTHAHVITGLVE 259          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP391_ARATH (Pentatricopeptide repeat-containing protein At5g18390, mitochondrial OS=Arabidopsis thaliana GN=At5g18390 PE=2 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 9.632e-11
Identity = 38/143 (26.57%), Postives = 72/143 (50.35%), Query Frame = 1
Query:   67 KNGYIVEALELFRTL-RILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            KNG++ +A+ELF  + + L C+  +  Y+ L+  LC       A+ L   + R  L  D  TY I+++  C+ GKM +A +   +M  +G  P     + L+ G +         E++ +M +   +PD  T +I+++ + K+
Sbjct:  158 KNGHVDQAVELFNGVPKTLGCQQTVDVYNSLLHALCDVKMFHGAYALIRRMIRKGLKPDKRTYAILVNGWCSAGKMKEAQEFLDEMSRRGFNPPARGRDLLIEGLLNAGYLESAKEMVSKMTKGGFVPDIQTFNILIEAISKS 300          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP318_ARATH (Putative pentatricopeptide repeat-containing protein At4g17915 OS=Arabidopsis thaliana GN=At4g17915 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.632e-11
Identity = 40/151 (26.49%), Postives = 77/151 (50.99%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            Y   +D LCK GYI  ALELF+ ++  + + ++ +Y+ LI+GLCKS R+  A  +   L +     + VTY  ++       ++ +   LFL+M+ +G   D  A+  ++   I+   T +  E +  +  +    D  + + +++L  K+
Sbjct:  157 YNVLLDALCKCGYIDNALELFKEMQS-RFKPELMTYNILINGLCKSRRVGTAKWMLTELKKSGYTPNAVTYTTILKLYFKTRRIRRGLQLFLEMKREGYTYDGYAYFAVVSALIKTGRTKEAYEYMQELVRKGRRHDIVSYNTLLNLYFKD 306          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP209_ARATH (Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana GN=At3g02650 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.632e-11
Identity = 42/156 (26.92%), Postives = 72/156 (46.15%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKS-GRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            + GV ++       I   CK G   EA  ++   +  +  L  R  + LI  LCK+ G +  A E+   L        +  ++ +IH+LC    +  A  L LDM +KG AP    FN ++  C +  +  +  E+L  M+ R + PD  T ++++
Sbjct:  294 KSGVLSEGEQMGNIITWFCKEGKAEEAYSVYELAKTKEKSLPPRFVATLITALCKNDGTITFAQEMLGDLSGEARRRGIKPFSDVIHSLCRMRNVKDAKALLLDMISKGPAPGNAVFNLVVHACSKTGDLDEAKEVLKLMESRGLKPDVYTYTVII 449          
The following BLAST results are available for this feature:
BLAST of FC929277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
PP124_ARATH5.647e-1125.95Pentatricopeptide repeat-containing protein At1g74... [more]
PPR81_ARATH7.375e-1125.32Pentatricopeptide repeat-containing protein At1g55... [more]
PP297_ARATH7.375e-1128.29Pentatricopeptide repeat-containing protein At4g01... [more]
PP196_ARATH7.375e-1127.81Pentatricopeptide repeat-containing protein At2g40... [more]
PP391_ARATH9.632e-1126.57Pentatricopeptide repeat-containing protein At5g18... [more]
PP318_ARATH9.632e-1126.49Putative pentatricopeptide repeat-containing prote... [more]
PP209_ARATH9.632e-1126.92Pentatricopeptide repeat-containing protein At3g02... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DD06RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DD06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929277 ID=FC929277|Name=FC929277|organism=Citrus clementina|type=EST|length=892bp
GGCACGAGGCGTCATGGCGTGGCAGCTGATACCTGGGCATATAGAACCTT
TATTGATGGGCTCTGCAAGAATGGTTATATTGTAGAGGCACTTGAACTAT
TTCGTACTTTGAGAATTCTCAAGTGTGAACTTGATATTCGATCCTACAGC
TGCCTCATTGATGGATTATGTAAATCCGGCAGACTCAAAATTGCATGGGA
ACTATTTCATAGTTTGCCTCGTGGAGTCCTAATAGCAGATGTTGTAACAT
ATAACATCATGATCCATGCGCTTTGTGCTGATGGAAAAATGGACAAGGCA
CATGATTTGTTTCTTGATATGGAAGCAAAAGGTGTAGCACCCGATTGTGT
CGCATTTAACACGCTGATGCTAGGTTGCATCCGCAATAATGAGACATCAA
AAGTTGTTGAACTCCTTCACAGAATGGATGAGAGAAATGTGATACCAGAT
GCATCTACACTTTCAATTGTTGTGGACTTACTTGTAAAGAATGAAATTAG
CTTAAACTCCATTCCACAATTCAAGAGTCAAAGGTAAGTGAGTTTAATAT
TGATTTAGTCGCATGTTTCTTCTGCCTGAAAACCCGATCTGGAGGATCCC
ATTCTTATTAACACGTGTAAAGGAGTGTTGTCTAATGTTGGCATGTTCCT
AGGTTCTGTCCATGGATTCTGTTTGCAGACATGGCTAACTTCTTGTCCAA
CAGATAAGTTTTAAAGTCTTTCAACTTTATGTTGTAAAATAACATTTTCA
TTATTCAATTCATGAGTTTTCCTTCTGTATCACATACTTCTCATTAGCTG
GAAGCGCAAATTTTTAGGCTTTTCCTGTATGGCCTCTTTTTCTGCTCTAA
TAAAATGGCATTTTATTTCCAAAAAAAAAAAAAAAAAAAAAA
back to top