FC929277

Overview
NameFC929277
Unique NameFC929277
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length892
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9258 contig Ccv1_Contig9258:11..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP105_ARATH (Pentatricopeptide repeat-containing protein At1g64580 OS=Arabidopsis thaliana GN=At1g64580 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 5.273e-17
Identity = 46/144 (31.94%), Postives = 76/144 (52.78%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIP 447
            G+  D + Y T I G C+ G +  A ++F  +       DI +Y+ L+D LC +G+++ A  +   L +  +  D++TYNI+I  LC   K+ +A  LF  +  KGV PD +A+ T++ G  R     +  +L  RM E   +P
Sbjct:  354 GLVGDAFTYNTLIHGYCQAGKLNVAQKVFNRMVDCGVSPDIVTYNILLDCLCNNGKIEKALVMVEDLQKSEMDVDIITYNIIIQGLCRTDKLKEAWCLFRSLTRKGVKPDAIAYITMISGLCRKGLQREADKLCRRMKEDGFMP 497          

HSP 2 Score: 87.8113 bits (216), Expect = 8.995e-17
Identity = 49/163 (30.06%), Postives = 87/163 (53.37%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNN-ETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            R  V  + + Y + I+G C +G + +A  +F  +    C  D+ +Y+ LI G CKS R++   +LF  +    L+ D  TYN +IH  C  GK++ A  +F  M   GV+PD V +N ++L C+ NN +  K + ++  + +  +  D  T +I++  L + +
Sbjct:  282 RRSVVPNVFTYNSLINGFCIHGCLGDAKYMFDLMVSKGCFPDVVTYNTLITGFCKSKRVEDGMKLFCEMTYQGLVGDAFTYNTLIHGYCQAGKLNVAQKVFNRMVDCGVSPDIVTYN-ILLDCLCNNGKIEKALVMVEDLQKSEMDVDIITYNIIIQGLCRTD 443          

HSP 3 Score: 81.6481 bits (200), Expect = 6.446e-15
Identity = 42/146 (28.77%), Postives = 78/146 (53.42%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDA 453
            G   D   Y T I G CK+  + + ++LF  +       D  +Y+ LI G C++G+L +A ++F+ +    +  D+VTYNI++  LC +GK++KA  +  D++   +  D + +N ++ G  R ++  +   L   +  + V PDA
Sbjct:  319 GCFPDVVTYNTLITGFCKSKRVEDGMKLFCEMTYQGLVGDAFTYNTLIHGYCQAGKLNVAQKVFNRMVDCGVSPDIVTYNILLDCLCNNGKIEKALVMVEDLQKSEMDVDIITYNIIIQGLCRTDKLKEAWCLFRSLTRKGVKPDA 464          

HSP 4 Score: 80.1073 bits (196), Expect = 1.875e-14
Identity = 46/155 (29.68%), Postives = 78/155 (50.32%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            + G+ AD   Y T I GL  +G   +A  L R +   K + ++  ++ LID   K G L  A  L+  + R  ++ +V TYN +I+  C  G +  A  +F  M +KG  PD V +NTL+ G  ++      ++L   M  + ++ DA T + ++
Sbjct:  212 KKGIRADAVTYNTLISGLSNSGRWTDAARLLRDMVKRKIDPNVIFFTALIDTFVKEGNLLEARNLYKEMIRRSVVPNVFTYNSLINGFCIHGCLGDAKYMFDLMVSKGCFPDVVTYNTLITGFCKSKRVEDGMKLFCEMTYQGLVGDAFTYNTLI 366          

HSP 5 Score: 74.7146 bits (182), Expect = 7.880e-13
Identity = 43/158 (27.22%), Postives = 77/158 (48.73%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G++ D +++   I   C+   +  AL L   +  L     I +   L++G C+  R + A  L  S+     + +VV YN +I+ LC +  ++ A ++F  ME KG+  D V +NTL+ G   +   +    LL  M +R + P+    + ++D  VK
Sbjct:  109 GISHDLYSFTILIHCFCRCSRLSLALALLGKMMKLGFRPSIVTLGSLLNGFCQGNRFQEAVSLVDSMDGFGFVPNVVIYNTVINGLCKNRDLNNALEVFYCMEKKGIRADAVTYNTLISGLSNSGRWTDAARLLRDMVKRKIDPNVIFFTALIDTFVK 266          

HSP 6 Score: 73.1738 bits (178), Expect = 2.293e-12
Identity = 43/151 (28.48%), Postives = 75/151 (49.67%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +   ID   K G ++EA  L++ +       ++ +Y+ LI+G C  G L  A  +F  +       DVVTYN +I   C   +++    LF +M  +G+  D   +NTL+ G  +  + +   ++ +RM +  V PD  T +I++D L  N
Sbjct:  257 FTALIDTFVKEGNLLEARNLYKEMIRRSVVPNVFTYNSLINGFCIHGCLGDAKYMFDLMVSKGCFPDVVTYNTLITGFCKSKRVEDGMKLFCEMTYQGLVGDAFTYNTLIHGYCQAGKLNVAQKVFNRMVDCGVSPDIVTYNILLDCLCNN 407          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP442_ARATH (Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.887e-17
Identity = 44/154 (28.57%), Postives = 83/154 (53.90%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G+  D   Y   ++GL KN  + +A E+FR +R      D+ SY  LI+G  K G ++ A  +F  +    L  +V+ YN+++   C  G+++KA +L  +M  KG+ P+ V + T++ G  ++ + ++   L   M  + ++PD+   + +VD
Sbjct:  587 GILGDAKTYTVLMNGLFKNDKVDDAEEIFREMRGKGIAPDVFSYGVLINGFSKLGNMQKASSIFDEMVEEGLTPNVIIYNMLLGGFCRSGEIEKAKELLDEMSVKGLHPNAVTYCTIIDGYCKSGDLAEAFRLFDEMKLKGLVPDSFVYTTLVD 740          

HSP 2 Score: 80.4925 bits (197), Expect = 1.436e-14
Identity = 45/157 (28.66%), Postives = 81/157 (51.59%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            R  GV  +       I+  CK G ++EA   +R++       D ++Y+ L++GL K+ ++  A E+F  +    +  DV +Y ++I+     G M KA  +F +M  +G+ P+ + +N L+ G  R+ E  K  ELL  M  + + P+A T   ++D
Sbjct:  549 RECGVLPNKVLCTGLINEYCKKGKVIEACSAYRSMVDQGILGDAKTYTVLMNGLFKNDKVDDAEEIFREMRGKGIAPDVFSYGVLINGFSKLGNMQKASSIFDEMVEEGLTPNVIIYNMLLGGFCRSGEIEKAKELLDEMSVKGLHPNAVTYCTIID 705          

HSP 3 Score: 74.7146 bits (182), Expect = 7.880e-13
Identity = 41/136 (30.15%), Postives = 70/136 (51.47%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVEL 414
            R  G+A D ++Y   I+G  K G + +A  +F  +       ++  Y+ L+ G C+SG ++ A EL   +    L  + VTY  +I   C  G + +A  LF +M+ KG+ PD   + TL+ GC R N+  + + +
Sbjct:  619 RGKGIAPDVFSYGVLINGFSKLGNMQKASSIFDEMVEEGLTPNVIIYNMLLGGFCRSGEIEKAKELLDEMSVKGLHPNAVTYCTIIDGYCKSGDLAEAFRLFDEMKLKGLVPDSFVYTTLVDGCCRLNDVERAITI 754          

HSP 4 Score: 71.2478 bits (173), Expect = 8.712e-12
Identity = 49/153 (32.03%), Postives = 69/153 (45.10%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+    + Y   IDGLCK   + +A  L   +  L   LD  +YS LIDGL K      A  L H +    +      Y+  I  +  +G M+KA  LF  M A G+ P   A+ +L+ G  R     +  ELL  M +RN++    T   VV
Sbjct:  272 GLVPLKYTYDVLIDGLCKIKRLEDAKSLLVEMDSLGVSLDNHTYSLLIDGLLKGRNADAAKGLVHEMVSHGINIKPYMYDCCICVMSKEGVMEKAKALFDGMIASGLIPQAQAYASLIEGYCREKNVRQGYELLVEMKKRNIVISPYTYGTVV 424          

HSP 5 Score: 68.9366 bits (167), Expect = 4.324e-11
Identity = 45/189 (23.81%), Postives = 82/189 (43.39%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRT-------------------LRILKCELDIR-------------------SYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSI 468
            G+  D++ Y T +DG C+   +  A+ +F T                    +  K EL                      +Y+ +ID LCK G L+ A ELFH +    L+  V+TY  +++     G+  +   +F +  A G+ PD + ++ ++   ++   T+K + L+ +M  +N + D   LSI
Sbjct:  727 GLVPDSFVYTTLVDGCCRLNDVERAITIFGTNKKGCASSTAPFNALINWVFKFGKTELKTEVLNRLMDGSFDRFGKPNDVTYNIMIDYLCKEGNLEAAKELFHQMQNANLMPTVITYTSLLNGYDKMGRRAEMFPVFDEAIAAGIEPDHIMYSVIINAFLKEGMTTKALVLVDQMFAKNAVDDGCKLSI 915          

HSP 6 Score: 68.5514 bits (166), Expect = 5.647e-11
Identity = 35/146 (23.97%), Postives = 72/146 (49.32%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPD 450
            HG+    + Y   I  + K G + +A  LF  +         ++Y+ LI+G C+   ++  +EL   + +  ++    TY  ++  +C+ G +D A+++  +M A G  P+ V + TL+   ++N+     + +L  M E+ + PD
Sbjct:  341 HGINIKPYMYDCCICVMSKEGVMEKAKALFDGMIASGLIPQAQAYASLIEGYCREKNVRQGYELLVEMKKRNIVISPYTYGTVVKGMCSSGDLDGAYNIVKEMIASGCRPNVVIYTTLIKTFLQNSRFGDAMRVLKEMKEQGIAPD 486          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP171_ARATH (Pentatricopeptide repeat-containing protein At2g26790, mitochondrial OS=Arabidopsis thaliana GN=At2g26790 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.887e-17
Identity = 46/138 (33.33%), Postives = 73/138 (52.90%), Query Frame = 1
Query:   64 CKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            CK    +EALE F+  R +   LD   Y+   D L K GR++ A+EL   +    ++ DV+ Y  +I   C  GK+  A DL  +M   G++PD + +N L+ G  RN    +V+E+  RM      P+A T S++++
Sbjct:  364 CKMDMCLEALEKFKEFRDMNIFLDRVCYNVAFDALSKLGRVEEAFELLQEMKDRGIVPDVINYTTLIDGYCLQGKVVDALDLIDEMIGNGMSPDLITYNVLVSGLARNGHEEEVLEIYERMKAEGPKPNAVTNSVIIE 501          

HSP 2 Score: 67.781 bits (164), Expect = 9.632e-11
Identity = 43/162 (26.54%), Postives = 78/162 (48.15%), Query Frame = 1
Query:   61 LCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIR----NNETSKVVELLHRMDERNVIPDASTLSIVVD-----LLVKNEISLNSIPQ 519
            LC  GY+ +A ++ + +   + E        +I   CK   ++ A  LF ++    LI D+ TY IMIH  C   ++ KA  LF DM+ +G+ PD V +  L+   ++    ++ET  V   + +     V+ + S   I +D     +L+  +  +N++ Q
Sbjct:  566 LCIEGYLEKAHDVLKKMSAYRVEPGRSMCGKMIGAFCKLNNVREAQVLFDTMVERGLIPDLFTYTIMIHTYCRLNELQKAESLFEDMKQRGIKPDVVTYTVLLDRYLKLDPEHHETCSVQGEVGKRKASEVLREFSAAGIGLDVVCYTVLIDRQCKMNNLEQ 727          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR78_ARATH (Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 8.995e-17
Identity = 47/154 (30.52%), Postives = 84/154 (54.55%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            D  AY   +D LCK+G +    ++F+ +  L  + D  S++  I   C +G +  A+++   + R  L+ +V T+N +I  LC + K+D A+ L  +M  KG  PD   +N++M     + E ++  +LL RMD    +PD  T ++V+ LL++
Sbjct:  242 DLLAYNALLDALCKSGDVDGGYKMFQEMGNLGLKPDAYSFAIFIHAYCDAGDVHSAYKVLDRMKRYDLVPNVYTFNHIIKTLCKNEKVDDAYLLLDEMIQKGANPDTWTYNSIMAYHCDHCEVNRATKLLSRMDRTKCLPDRHTYNMVLKLLIR 395          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP344_ARATH (Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 8.995e-17
Identity = 52/164 (31.71%), Postives = 87/164 (53.05%), Query Frame = 1
Query:    1 GTRRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            G +  G+  D+  Y   +    K G I EA++L   +    CE D+   + LI+ L K+ R+  AW++F  +    L   VVTYN ++  L  +GK+ +A +LF  M  KG  P+ + FNTL     +N+E +  +++L +M +   +PD  T + ++  LVKN
Sbjct:  493 GLKDIGLVPDSVTYNMMMKCYSKVGEIDEAIKLLSEMMENGCEPDVIVVNSLINTLYKADRVDEAWKMFMRMKEMKLKPTVVTYNTLLAGLGKNGKIQEAIELFEGMVQKGCPPNTITFNTLFDCLCKNDEVTLALKMLFKMMDMGCVPDVFTYNTIIFGLVKN 656          

HSP 2 Score: 76.2554 bits (186), Expect = 2.708e-13
Identity = 41/146 (28.08%), Postives = 77/146 (52.74%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRM-DERNVIPDASTLSIVV 474
            Y   IDGL K+G + EA +LF  +    C  +   Y+ LI+G  K+G    A  LF  + +  +  D+ TY++++  LC  G++D+    F +++  G+ PD V +N ++ G  +++   + + L + M   R + PD  T + ++
Sbjct:  894 YGPLIDGLSKSGRLYEAKQLFEGMLDYGCRPNCAIYNILINGFGKAGEADAACALFKRMVKEGVRPDLKTYSVLVDCLCMVGRVDEGLHYFKELKESGLNPDVVCYNLIINGLGKSHRLEEALVLFNEMKTSRGITPDLYTYNSLI 1039          

HSP 3 Score: 75.0998 bits (183), Expect = 6.033e-13
Identity = 47/157 (29.94%), Postives = 75/157 (47.77%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVV-TYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            G   D   Y   +D   K+G I E  EL++ +   +CE +  +++ +I GL K+G +  A +L++ L      +    TY  +I  L   G++ +A  LF  M   G  P+C  +N L+ G  +  E      L  RM +  V PD  T S++VD L
Sbjct:  815 GCIPDVATYNFLLDAYGKSGKIDELFELYKEMSTHECEANTITHNIVISGLVKAGNVDDALDLYYDLMSDRDFSPTACTYGPLIDGLSKSGRLYEAKQLFEGMLDYGCRPNCAIYNILINGFGKAGEADAACALFKRMVKEGVRPDLKTYSVLVDCL 971          

HSP 4 Score: 74.3294 bits (181), Expect = 1.029e-12
Identity = 45/173 (26.01%), Postives = 81/173 (46.82%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKSQR 534
            G   D   Y   ID LC    +  A E+F  ++  + + D  +Y  L+D    +  L    + +  + +   + DVVT+ I++ ALC  G   +A D    M  +G+ P+   +NTL+ G +R +     +EL   M+   V P A T  + +D   K+  S++++  F+  +
Sbjct:  288 GCGPDVVTYTVLIDALCTARKLDCAKEVFEKMKTGRHKPDRVTYITLLDRFSDNRDLDSVKQFWSEMEKDGHVPDVVTFTILVDALCKAGNFGEAFDTLDVMRDQGILPNLHTYNTLICGLLRVHRLDDALELFGNMESLGVKPTAYTYIVFIDYYGKSGDSVSALETFEKMK 460          

HSP 5 Score: 72.7886 bits (177), Expect = 2.994e-12
Identity = 41/159 (25.79%), Postives = 83/159 (52.20%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +G   D     + I+ L K   + EA ++F  ++ +K +  + +Y+ L+ GL K+G+++ A ELF  + +     + +T+N +   LC + ++  A  +   M   G  PD   +NT++ G ++N +  + +   H+M ++ V PD  TL  ++  +VK
Sbjct:  532 NGCEPDVIVVNSLINTLYKADRVDEAWKMFMRMKEMKLKPTVVTYNTLLAGLGKNGKIQEAIELFEGMVQKGCPPNTITFNTLFDCLCKNDEVTLALKMLFKMMDMGCVPDVFTYNTIIFGLVKNGQVKEAMCFFHQM-KKLVYPDFVTLCTLLPGVVK 689          

HSP 6 Score: 69.707 bits (169), Expect = 2.535e-11
Identity = 46/159 (28.93%), Postives = 78/159 (49.06%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            GV    + Y  FID   K+G  V ALE F  ++      +I + +  +  L K+GR + A ++F+ L    L+ D VTYN+M+      G++D+A  L  +M   G  PD +  N+L+    + +   +  ++  RM E  + P   T + ++  L KN
Sbjct:  428 GVKPTAYTYIVFIDYYGKSGDSVSALETFEKMKTKGIAPNIVACNASLYSLAKAGRDREAKQIFYGLKDIGLVPDSVTYNMMMKCYSKVGEIDEAIKLLSEMMENGCEPDVIVVNSLINTLYKADRVDEAWKMFMRMKEMKLKPTVVTYNTLLAGLGKN 586          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR54_ARATH (Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.175e-16
Identity = 49/167 (29.34%), Postives = 90/167 (53.89%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSI 513
            +G   D  A+   I  L +     EA   F +L+  + E D+  Y+ L+ G C++G +  A ++F  +    +  +V TY+I+I ALC  G++ +AHD+F DM   G AP+ + FN LM   ++   T KV+++ ++M +    PD  T + +++   ++E   N++
Sbjct:  215 YGCVPDKIAFSIVISNLSRKRRASEAQSFFDSLKD-RFEPDVIVYTNLVRGWCRAGEISEAEKVFKEMKLAGIEPNVYTYSIVIDALCRCGQISRAHDVFADMLDSGCAPNAITFNNLMRVHVKAGRTEKVLQVYNQMKKLGCEPDTITYNFLIEAHCRDENLENAV 380          

HSP 2 Score: 71.633 bits (174), Expect = 6.670e-12
Identity = 37/154 (24.03%), Postives = 78/154 (50.65%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            D   Y   + G C+ G I EA ++F+ +++   E ++ +YS +ID LC+ G++  A ++F  +       + +T+N ++      G+ +K   ++  M+  G  PD + +N L+    R+      V++L+ M ++    +AST + +   + K
Sbjct:  254 DVIVYTNLVRGWCRAGEISEAEKVFKEMKLAGIEPNVYTYSIVIDALCRCGQISRAHDVFADMLDSGCAPNAITFNNLMRVHVKAGRTEKVLQVYNQMKKLGCEPDTITYNFLIEAHCRDENLENAVKVLNTMIKKKCEVNASTFNTIFRYIEK 407          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP444_ARATH (Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.175e-16
Identity = 44/159 (27.67%), Postives = 83/159 (52.20%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +G+  D   Y + I G  K G +  ALE+   +R   C+ ++ SY+ L+DG CK G++  A+ + + +    L  + V +N +I A C + ++ +A ++F +M  KG  PD   FN+L+ G    +E    + LL  M    V+ +  T + +++  ++
Sbjct:  383 YGIVPDVCTYNSLIYGYWKEGLVGLALEVLHDMRNKGCKPNVYSYTILVDGFCKLGKIDEAYNVLNEMSADGLKPNTVGFNCLISAFCKEHRIPEAVEIFREMPRKGCKPDVYTFNSLISGLCEVDEIKHALWLLRDMISEGVVANTVTYNTLINAFLR 541          

HSP 2 Score: 82.0333 bits (201), Expect = 4.935e-15
Identity = 47/158 (29.75%), Postives = 78/158 (49.37%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            GV A+T  Y T I+   + G I EA +L   +      LD  +Y+ LI GLC++G +  A  LF  + R       ++ NI+I+ LC  G +++A +   +M  +G  PD V FN+L+ G  R       + +  ++    + PD  T + ++  L K
Sbjct:  524 GVVANTVTYNTLINAFLRRGEIKEARKLVNEMVFQGSPLDEITYNSLIKGLCRAGEVDKARSLFEKMLRDGHAPSNISCNILINGLCRSGMVEEAVEFQKEMVLRGSTPDIVTFNSLINGLCRAGRIEDGLTMFRKLQAEGIPPDTVTFNTLMSWLCK 681          

HSP 3 Score: 78.1814 bits (191), Expect = 7.127e-14
Identity = 50/162 (30.86%), Postives = 82/162 (50.62%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSC--LIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            G   D   Y + I GLC+ G + +A  LF   ++L+      + SC  LI+GLC+SG ++ A E    +       D+VT+N +I+ LC  G+++    +F  ++A+G+ PD V FNTLM    +         LL    E   +P+  T SI++  ++  E
Sbjct:  559 GSPLDEITYNSLIKGLCRAGEVDKARSLFE--KMLRDGHAPSNISCNILINGLCRSGMVEEAVEFQKEMVLRGSTPDIVTFNSLINGLCRAGRIEDGLTMFRKLQAEGIPPDTVTFNTLMSWLCKGGFVYDACLLLDEGIEDGFVPNHRTWSILLQSIIPQE 718          

HSP 4 Score: 77.7962 bits (190), Expect = 9.308e-14
Identity = 48/160 (30.00%), Postives = 83/160 (51.88%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIA-WELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            G+  +T  +   I   CK   I EA+E+FR +    C+ D+ +++ LI GLC+   +K A W L   +  GV +A+ VTYN +I+A    G++ +A  L  +M  +G   D + +N+L+ G  R  E  K   L  +M      P   + +I+++ L ++
Sbjct:  454 GLKPNTVGFNCLISAFCKEHRIPEAVEIFREMPRKGCKPDVYTFNSLISGLCEVDEIKHALWLLRDMISEGV-VANTVTYNTLINAFLRRGEIKEARKLVNEMVFQGSPLDEITYNSLIKGLCRAGEVDKARSLFEKMLRDGHAPSNISCNILINGLCRS 612          

HSP 5 Score: 77.0258 bits (188), Expect = 1.588e-13
Identity = 43/140 (30.71%), Postives = 70/140 (50.00%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRM 426
            R  G   + ++Y   +DG CK G I EA  +   +     + +   ++CLI   CK  R+  A E+F  +PR     DV T+N +I  LC   ++  A  L  DM ++GV  + V +NTL+   +R  E  +  +L++ M
Sbjct:  416 RNKGCKPNVYSYTILVDGFCKLGKIDEAYNVLNEMSADGLKPNTVGFNCLISAFCKEHRIPEAVEIFREMPRKGCKPDVYTFNSLISGLCEVDEIKHALWLLRDMISEGVVANTVTYNTLINAFLRRGEIKEARKLVNEM 555          

HSP 6 Score: 70.8626 bits (172), Expect = 1.138e-11
Identity = 43/156 (27.56%), Postives = 78/156 (50.00%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRM-DERNVIPDASTLSIVV 474
            +HG   ++  Y+T I  L K   + EAL+L   + ++ C  D  +++ +I GLCK  R+  A ++ + +       D +TY  +++ LC  G++D A DLF  +      P+ V FNTL+ G + +        +L  M     ++PD  T + ++
Sbjct:  245 KHGCVPNSVIYQTLIHSLSKCNRVNEALQLLEEMFLMGCVPDAETFNDVILGLCKFDRINEAAKMVNRMLIRGFAPDDITYGYLMNGLCKIGRVDAAKDLFYRIP----KPEIVIFNTLIHGFVTHGRLDDAKAVLSDMVTSYGIVPDVCTYNSLI 396          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP292_ARATH (Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.004e-16
Identity = 48/146 (32.88%), Postives = 80/146 (54.79%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRIL-KCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDA 453
            + AD+  + T IDGLCK G + EA EL   +++  +C  +  +Y+CLIDG C++G+L+ A E+   +    +  +VVT N ++  +C    ++ A   F+DME +GV  + V + TL+  C   +   K +    +M E    PDA
Sbjct:  366 IKADSIHFNTLIDGLCKVGRLKEAEELLVRMKLEERCAPNAVTYNCLIDGYCRAGKLETAKEVVSRMKEDEIKPNVVTVNTIVGGMCRHHGLNMAVVFFMDMEKEGVKGNVVTYMTLIHACCSVSNVEKAMYWYEKMLEAGCSPDA 511          

HSP 2 Score: 77.0258 bits (188), Expect = 1.588e-13
Identity = 41/156 (26.28%), Postives = 72/156 (46.15%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + GV  +   Y T I   C    + +A+  +  +    C  D + Y  LI GLC+  R   A  +   L  G    D++ YN++I   C     +K +++  DME +G  PD + +NTL+    ++ +   V  ++ +M E  + P  +T   V+D
Sbjct:  469 KEGVKGNVVTYMTLIHACCSVSNVEKAMYWYEKMLEAGCSPDAKIYYALISGLCQVRRDHDAIRVVEKLKEGGFSLDLLAYNMLIGLFCDKNNTEKVYEMLTDMEKEGKKPDSITYNTLISFFGKHKDFESVERMMEQMREDGLDPTVTTYGAVID 624          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP133_ARATH (Pentatricopeptide repeat-containing protein At1g79540 OS=Arabidopsis thaliana GN=At1g79540 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.004e-16
Identity = 50/155 (32.26%), Postives = 80/155 (51.61%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            D+ A+   +DG CK G +VEA EL R        L +R YS LIDGL ++ R   A+EL+ ++ +  +  D++ Y I+I  L   GK++ A  L   M +KG++PD   +N ++          +   L   M E    PDA T +I++  + +N
Sbjct:  267 DSVAHNALLDGFCKLGRMVEAFELLRLFEKDGFVLGLRGYSSLIDGLFRARRYTQAFELYANMLKKNIKPDIILYTILIQGLSKAGKIEDALKLLSSMPSKGISPDTYCYNAVIKALCGRGLLEEGRSLQLEMSETESFPDACTHTILICSMCRN 421          

HSP 2 Score: 75.485 bits (184), Expect = 4.619e-13
Identity = 49/174 (28.16%), Postives = 77/174 (44.25%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRG-------------------------VLIA--------------DVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDE 432
            D   +   I  +C+NG + EA E+F  +    C   + +++ LIDGLCKSG LK A  L H +  G                         +L A              D+V+YN++I+  C  G +D A  L   ++ KG++PD V +NTL+ G  R     +  +L +  D+
Sbjct:  407 DACTHTILICSMCRNGLVREAEEIFTEIEKSGCSPSVATFNALIDGLCKSGELKEARLLLHKMEVGRPASLFLRLSHSGNRSFDTMVESGSILKAYRDLAHFADTGSSPDIVSYNVLINGFCRAGDIDGALKLLNVLQLKGLSPDSVTYNTLINGLHRVGREEEAFKLFYAKDD 580          

HSP 3 Score: 75.0998 bits (183), Expect = 6.033e-13
Identity = 43/151 (28.48%), Postives = 73/151 (48.34%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            Y + IDGL +     +A EL+  +     + DI  Y+ LI GL K+G+++ A +L  S+P   +  D   YN +I ALC  G +++   L L+M      PD      L+    RN    +  E+   +++    P  +T + ++D L K+
Sbjct:  306 YSSLIDGLFRARRYTQAFELYANMLKKNIKPDIILYTILIQGLSKAGKIEDALKLLSSMPSKGISPDTYCYNAVIKALCGRGLLEEGRSLQLEMSETESFPDACTHTILICSMCRNGLVREAEEIFTEIEKSGCSPSVATFNALIDGLCKS 456          

HSP 4 Score: 69.707 bits (169), Expect = 2.535e-11
Identity = 39/156 (25.00%), Postives = 75/156 (48.08%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            G++ +   Y   I GLC+ G   +A +LF  ++      D  +++ L+DG CK GR+  A+EL     +   +  +  Y+ +I  L    +  +A +L+ +M  K + PD + +  L+ G  +  +    ++LL  M  + + PD    + V+  L
Sbjct:  228 GISPNRVTYTILISGLCQRGSADDARKLFYEMQTSGNYPDSVAHNALLDGFCKLGRMVEAFELLRLFEKDGFVLGLRGYSSLIDGLFRARRYTQAFELYANMLKKNIKPDIILYTILIQGLSKAGKIEDALKLLSSMPSKGISPDTYCYNAVIKAL 383          

HSP 5 Score: 68.1662 bits (165), Expect = 7.375e-11
Identity = 39/140 (27.86%), Postives = 67/140 (47.86%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMD 429
            +  +  D   Y   I GL K G I +AL+L  ++       D   Y+ +I  LC  G L+    L   +       D  T+ I+I ++C +G + +A ++F ++E  G +P    FN L+ G  ++ E  +   LLH+M+
Sbjct:  331 KKNIKPDIILYTILIQGLSKAGKIEDALKLLSSMPSKGISPDTYCYNAVIKALCGRGLLEEGRSLQLEMSETESFPDACTHTILICSMCRNGLVREAEEIFTEIEKSGCSPSVATFNALIDGLCKSGELKEARLLLHKME 470          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP412_ARATH (Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.617e-16
Identity = 44/154 (28.57%), Postives = 78/154 (50.65%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G+  D   Y T ID LCKNG++  AL LF  +       D+  Y+ L++GLC SGR + A  L   + +  +  DV+T+N +I A   +GK   A +L+ +M    +AP+   + +L+ G        +  ++ + M+ +   PD    + +++
Sbjct:  172 GIKPDVVMYTTIIDSLCKNGHVNYALSLFDQMENYGIRPDVVMYTSLVNGLCNSGRWRDADSLLRGMTKRKIKPDVITFNALIDAFVKEGKFLDAEELYNEMIRMSIAPNIFTYTSLINGFCMEGCVDEARQMFYLMETKGCFPDVVAYTSLIN 325          

HSP 2 Score: 83.9593 bits (206), Expect = 1.299e-15
Identity = 41/154 (26.62%), Postives = 83/154 (53.90%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            +G+  D   Y + ++GLC +G   +A  L R +   K + D+ +++ LID   K G+   A EL++ + R  +  ++ TY  +I+  C +G +D+A  +F  ME KG  PD VA+ +L+ G  +  +    +++ + M ++ +  +  T + ++
Sbjct:  206 YGIRPDVVMYTSLVNGLCNSGRWRDADSLLRGMTKRKIKPDVITFNALIDAFVKEGKFLDAEELYNEMIRMSIAPNIFTYTSLINGFCMEGCVDEARQMFYLMETKGCFPDVVAYTSLINGFCKCKKVDDAMKIFYEMSQKGLTGNTITYTTLI 359          

HSP 3 Score: 83.5741 bits (205), Expect = 1.696e-15
Identity = 43/108 (39.81%), Postives = 65/108 (60.19%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVA 339
            GVA + W Y   + GLC NG + +AL +F  +R  + ++ I +Y+ +I G+CK+G++K A  LF SLP   +  +VVTY  MI  L  +G   +AH LF  M+  GV+
Sbjct:  420 GVAPNIWTYNVLLHGLCYNGKLEKALMVFEDMRKREMDIGIITYTIIIQGMCKAGKVKNAVNLFCSLPSKGVKPNVVTYTTMISGLFREGLKHEAHVLFRKMKEDGVS 527          

HSP 4 Score: 78.1814 bits (191), Expect = 7.127e-14
Identity = 57/209 (27.27%), Postives = 96/209 (45.93%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKS-----------------------------------GRLKIAWELF-HSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDM---EAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL-----VKNEISL 504
            R  +A + + Y + I+G C  G + EA ++F  +    C  D+ +Y+ LI+G CK                                    G+  +A E+F H + RGV   ++ TYN+++H LC +GK+ KA  +F DM   E  GVAP+   +N L+ G   N +  K + +   M +R +     T +I++  +     VKN ++L
Sbjct:  275 RMSIAPNIFTYTSLINGFCMEGCVDEARQMFYLMETKGCFPDVVAYTSLINGFCKCKKVDDAMKIFYEMSQKGLTGNTITYTTLIQGFGQVGKPNVAQEVFSHMVSRGV-PPNIRTYNVLLHCLCYNGKVKKALMIFEDMQKREMDGVAPNIWTYNVLLHGLCYNGKLEKALMVFEDMRKREMDIGIITYTIIIQGMCKAGKVKNAVNL 482          

HSP 5 Score: 77.7962 bits (190), Expect = 9.308e-14
Identity = 45/147 (30.61%), Postives = 77/147 (52.38%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELD-----IRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNV 441
            GV  +   Y   +  LC NG + +AL +F  ++  K E+D     I +Y+ L+ GLC +G+L+ A  +F  + +  +   ++TY I+I  +C  GK+  A +LF  + +KGV P+ V + T++ G  R     +   L  +M E  V
Sbjct:  382 GVPPNIRTYNVLLHCLCYNGKVKKALMIFEDMQ--KREMDGVAPNIWTYNVLLHGLCYNGKLEKALMVFEDMRKREMDIGIITYTIIIQGMCKAGKVKNAVNLFCSLPSKGVKPNVVTYTTMISGLFREGLKHEAHVLFRKMKEDGV 526          

HSP 6 Score: 74.3294 bits (181), Expect = 1.029e-12
Identity = 44/158 (27.85%), Postives = 76/158 (48.10%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            GV+ D +     ++  C++     A      +  L  E DI +++ LI+G C   R++ A  + + +    +  DVV Y  +I +LC +G ++ A  LF  ME  G+ PD V + +L+ G   +        LL  M +R + PD  T + ++D  VK
Sbjct:  102 GVSHDLYTCNLLMNCFCQSSQPYLASSFLGKMMKLGFEPDIVTFTSLINGFCLGNRMEEAMSMVNQMVEMGIKPDVVMYTTIIDSLCKNGHVNYALSLFDQMENYGIRPDVVMYTSLVNGLCNSGRWRDADSLLRGMTKRKIKPDVITFNALIDAFVK 259          

HSP 7 Score: 74.3294 bits (181), Expect = 1.029e-12
Identity = 42/164 (25.61%), Postives = 78/164 (47.56%), Query Frame = 1
Query:    1 GTRRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            G  +  +  D   +   ID   K G  ++A EL+  +  +    +I +Y+ LI+G C  G +  A ++F+ +       DVV Y  +I+  C   K+D A  +F +M  KG+  + + + TL+ G  +  + +   E+   M  R V P+  T ++++  L  N
Sbjct:  237 GMTKRKIKPDVITFNALIDAFVKEGKFLDAEELYNEMIRMSIAPNIFTYTSLINGFCMEGCVDEARQMFYLMETKGCFPDVVAYTSLINGFCKCKKVDDAMKIFYEMSQKGLTGNTITYTTLIQGFGQVGKPNVAQEVFSHMVSRGVPPNIRTYNVLLHCLCYN 400          

HSP 8 Score: 73.559 bits (179), Expect = 1.755e-12
Identity = 38/154 (24.68%), Postives = 73/154 (47.40%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G   D   + + I+G C    + EA+ +   +  +  + D+  Y+ +ID LCK+G +  A  LF  +    +  DVV Y  +++ LC  G+   A  L   M  + + PD + FN L+   ++  +     EL + M   ++ P+  T + +++
Sbjct:  137 GFEPDIVTFTSLINGFCLGNRMEEAMSMVNQMVEMGIKPDVVMYTTIIDSLCKNGHVNYALSLFDQMENYGIRPDVVMYTSLVNGLCNSGRWRDADSLLRGMTKRKIKPDVITFNALIDAFVKEGKFLDAEELYNEMIRMSIAPNIFTYTSLIN 290          

HSP 9 Score: 67.781 bits (164), Expect = 9.632e-11
Identity = 41/176 (23.30%), Postives = 85/176 (48.30%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVL---IADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKSQR 534
            G+  +T  Y T I G  + G    A E+F  +       +IR+Y+ L+  LC +G++K A  +F  + +  +     ++ TYN+++H LC +GK++KA  +F DM  + +    + +  ++ G  +  +    V L   +  + V P+  T + ++  L +  +   +   F+  +
Sbjct:  347 GLTGNTITYTTLIQGFGQVGKPNVAQEVFSHMVSRGVPPNIRTYNVLLHCLCYNGKVKKALMIFEDMQKREMDGVAPNIWTYNVLLHGLCYNGKLEKALMVFEDMRKREMDIGIITYTIIIQGMCKAGKVKNAVNLFCSLPSKGVKPNVVTYTTMISGLFREGLKHEAHVLFRKMK 522          
The following BLAST results are available for this feature:
BLAST of FC929277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
PP105_ARATH5.273e-1731.94Pentatricopeptide repeat-containing protein At1g64... [more]
PP442_ARATH6.887e-1728.57Pentatricopeptide repeat-containing protein At5g61... [more]
PP171_ARATH6.887e-1733.33Pentatricopeptide repeat-containing protein At2g26... [more]
PPR78_ARATH8.995e-1730.52Pentatricopeptide repeat-containing protein At1g52... [more]
PP344_ARATH8.995e-1731.71Pentatricopeptide repeat-containing protein At4g31... [more]
PPR54_ARATH1.175e-1629.34Pentatricopeptide repeat-containing protein At1g20... [more]
PP444_ARATH1.175e-1627.67Pentatricopeptide repeat-containing protein At5g64... [more]
PP292_ARATH2.004e-1632.88Pentatricopeptide repeat-containing protein At3g61... [more]
PP133_ARATH2.004e-1632.26Pentatricopeptide repeat-containing protein At1g79... [more]
PP412_ARATH2.617e-1628.57Pentatricopeptide repeat-containing protein At5g41... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DD06RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DD06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929277 ID=FC929277|Name=FC929277|organism=Citrus clementina|type=EST|length=892bp
GGCACGAGGCGTCATGGCGTGGCAGCTGATACCTGGGCATATAGAACCTT
TATTGATGGGCTCTGCAAGAATGGTTATATTGTAGAGGCACTTGAACTAT
TTCGTACTTTGAGAATTCTCAAGTGTGAACTTGATATTCGATCCTACAGC
TGCCTCATTGATGGATTATGTAAATCCGGCAGACTCAAAATTGCATGGGA
ACTATTTCATAGTTTGCCTCGTGGAGTCCTAATAGCAGATGTTGTAACAT
ATAACATCATGATCCATGCGCTTTGTGCTGATGGAAAAATGGACAAGGCA
CATGATTTGTTTCTTGATATGGAAGCAAAAGGTGTAGCACCCGATTGTGT
CGCATTTAACACGCTGATGCTAGGTTGCATCCGCAATAATGAGACATCAA
AAGTTGTTGAACTCCTTCACAGAATGGATGAGAGAAATGTGATACCAGAT
GCATCTACACTTTCAATTGTTGTGGACTTACTTGTAAAGAATGAAATTAG
CTTAAACTCCATTCCACAATTCAAGAGTCAAAGGTAAGTGAGTTTAATAT
TGATTTAGTCGCATGTTTCTTCTGCCTGAAAACCCGATCTGGAGGATCCC
ATTCTTATTAACACGTGTAAAGGAGTGTTGTCTAATGTTGGCATGTTCCT
AGGTTCTGTCCATGGATTCTGTTTGCAGACATGGCTAACTTCTTGTCCAA
CAGATAAGTTTTAAAGTCTTTCAACTTTATGTTGTAAAATAACATTTTCA
TTATTCAATTCATGAGTTTTCCTTCTGTATCACATACTTCTCATTAGCTG
GAAGCGCAAATTTTTAGGCTTTTCCTGTATGGCCTCTTTTTCTGCTCTAA
TAAAATGGCATTTTATTTCCAAAAAAAAAAAAAAAAAAAAAA
back to top