FC929277

Overview
NameFC929277
Unique NameFC929277
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length892
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9258 contig Ccv1_Contig9258:11..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP401_ARATH (Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.617e-16
Identity = 48/146 (32.88%), Postives = 80/146 (54.79%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRIL-KCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDA 453
            + AD+  + T IDGLCK G + EA EL   +++  +C  +  +Y+CLIDG C++G+L+ A E+   +    +  +VVT N ++  +C    ++ A   F+DME +GV  + V + TL+  C   +   K +    +M E    PDA
Sbjct:  366 IKADSIHFNTLIDGLCKVGRLKEAEELLVRMKLEERCVPNAVTYNCLIDGYCRAGKLETAKEVVSRMKEDEIKPNVVTVNTIVGGMCRHHGLNMAVVFFMDMEKEGVKGNVVTYMTLIHACCSVSNVEKAMYWYEKMLEAGCSPDA 511          

HSP 2 Score: 77.0258 bits (188), Expect = 1.588e-13
Identity = 41/156 (26.28%), Postives = 72/156 (46.15%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + GV  +   Y T I   C    + +A+  +  +    C  D + Y  LI GLC+  R   A  +   L  G    D++ YN++I   C     +K +++  DME +G  PD + +NTL+    ++ +   V  ++ +M E  + P  +T   V+D
Sbjct:  469 KEGVKGNVVTYMTLIHACCSVSNVEKAMYWYEKMLEAGCSPDAKIYYALISGLCQVRRDHDAIRVVEKLKEGGFSLDLLAYNMLIGLFCDKNNAEKVYEMLTDMEKEGKKPDSITYNTLISFFGKHKDFESVERMMEQMREDGLDPTVTTYGAVID 624          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP396_ARATH (Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.617e-16
Identity = 45/142 (31.69%), Postives = 80/142 (56.34%), Query Frame = 1
Query:   52 IDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            +D   KNG +V+ALE+++ +       D   Y+ +I GLC SG +  A+     + +  +  DV TYN +I ALC +GK D+A DL   M+  GVAPD +++  ++ G   + + ++  E L  M + +++P+    ++V+D
Sbjct:  272 MDSCFKNGNVVQALEVWKEMSQKNVPADSVVYNVIIRGLCSSGNMVAAYGFMCDMVKRGVNPDVFTYNTLISALCKEGKFDEACDLHGTMQNGGVAPDQISYKVIIQGLCIHGDVNRANEFLLSMLKSSLLPEVLLWNVVID 413          

HSP 2 Score: 77.0258 bits (188), Expect = 1.588e-13
Identity = 44/157 (28.03%), Postives = 79/157 (50.32%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            V AD+  Y   I GLC +G +V A      +       D+ +Y+ LI  LCK G+   A +L  ++  G +  D ++Y ++I  LC  G +++A++  L M    + P+ + +N ++ G  R  +TS  + +L+ M    V P+  T + ++   VK
Sbjct:  296 VPADSVVYNVIIRGLCSSGNMVAAYGFMCDMVKRGVNPDVFTYNTLISALCKEGKFDEACDLHGTMQNGGVAPDQISYKVIIQGLCIHGDVNRANEFLLSMLKSSLLPEVLLWNVVIDGYGRYGDTSSALSVLNLMLSYGVKPNVYTNNALIHGYVK 452          

HSP 3 Score: 72.0182 bits (175), Expect = 5.107e-12
Identity = 46/157 (29.30%), Postives = 76/157 (48.41%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKM----DKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            GV      +   ++GLCK GYI +A  L R +R +    +  SY+ LI GLC    +  A  LF+++ +  +  + VT NI++HALC  G +     K  +  LD        D V    LM  C +N    + +E+   M ++NV  D+   ++++
Sbjct:  151 GVIPGLITHNHLLNGLCKAGYIEKADGLVREMREMGPSPNCVSYNTLIKGLCSVNNVDKALYLFNTMNKYGIRPNRVTCNIIVHALCQKGVIGNNNKKLLEEILDSSQANAPLDIVICTILMDSCFKNGNVVQALEVWKEMSQKNVPADSVVYNVII 307          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP360_ARATH (Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.617e-16
Identity = 49/156 (31.41%), Postives = 82/156 (52.56%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            R G++ D+  YR+ +   CK G +VE  ++F  +R      D+  +S ++    +SG L  A   F+S+    LI D V Y I+I   C  G +  A +L  +M  +G A D V +NT++ G  +     +  +L + M ER + PD+ TL+I++D
Sbjct:  333 RSGLSPDSTTYRSLLMEACKKGDVVETEKVFSDMRSRDVVPDLVCFSSMMSLFTRSGNLDKALMYFNSVKEAGLIPDNVIYTILIQGYCRKGMISVAMNLRNEMLQQGCAMDVVTYNTILHGLCKRKMLGEADKLFNEMTERALFPDSYTLTILID 488          

HSP 2 Score: 81.6481 bits (200), Expect = 6.446e-15
Identity = 41/156 (26.28%), Postives = 85/156 (54.49%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            D++     IDG CK G +  A+ELF+ ++  +  LD+ +Y+ L+DG  K G +  A E++  +    ++   ++Y+I+++ALC+ G + +A  ++ +M +K + P  +  N+++ G  R+   S     L +M     +PD  + + ++   V+ E
Sbjct:  479 DSYTLTILIDGHCKLGNLQNAMELFQKMKEKRIRLDVVTYNTLLDGFGKVGDIDTAKEIWADMVSKEILPTPISYSILVNALCSKGHLAEAFRVWDEMISKNIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVREE 634          

HSP 3 Score: 78.5666 bits (192), Expect = 5.457e-14
Identity = 40/161 (24.84%), Postives = 81/161 (50.31%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            R GV  + +     ++ LCK+G + +       ++      DI +Y+ LI      G ++ A+EL +++P       V TYN +I+ LC  GK ++A ++F +M   G++PD   + +L++   +  +  +  ++   M  R+V+PD    S ++ L  ++
Sbjct:  228 RSGVGINVYTLNIMVNALCKDGKMEKVGTFLSQVQEKGVYPDIVTYNTLISAYSSKGLMEEAFELMNAMPGKGFSPGVYTYNTVINGLCKHGKYERAKEVFAEMLRSGLSPDSTTYRSLLMEACKKGDVVETEKVFSDMRSRDVVPDLVCFSSMMSLFTRS 388          

HSP 4 Score: 78.1814 bits (191), Expect = 7.127e-14
Identity = 46/156 (29.49%), Postives = 75/156 (48.08%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            G+  D   Y   I G C+ G I  A+ L   +    C +D+ +Y+ ++ GLCK   L  A +LF+ +    L  D  T  I+I   C  G +  A +LF  M+ K +  D V +NTL+ G  +  +     E+   M  + ++P   + SI+V+ L
Sbjct:  405 GLIPDNVIYTILIQGYCRKGMISVAMNLRNEMLQQGCAMDVVTYNTILHGLCKRKMLGEADKLFNEMTERALFPDSYTLTILIDGHCKLGNLQNAMELFQKMKEKRIRLDVVTYNTLLDGFGKVGDIDTAKEIWADMVSKEILPTPISYSILVNAL 560          

HSP 5 Score: 77.411 bits (189), Expect = 1.216e-13
Identity = 44/136 (32.35%), Postives = 71/136 (52.21%), Query Frame = 1
Query:   85 EALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            EA E F  LR     + I + + LI  L + G +++AW ++  + R  +  +V T NIM++ALC DGKM+K       ++ KGV PD V +NTL+          +  EL++ M  +   P   T + V++ L K+
Sbjct:  183 EAHEAFTLLRSKGFTVSIDACNALIGSLVRIGWVELAWGVYQEISRSGVGINVYTLNIMVNALCKDGKMEKVGTFLSQVQEKGVYPDIVTYNTLISAYSSKGLMEEAFELMNAMPGKGFSPGVYTYNTVINGLCKH 318          

HSP 6 Score: 75.0998 bits (183), Expect = 6.033e-13
Identity = 43/146 (29.45%), Postives = 71/146 (48.63%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIP 447
            + G A D   Y T + GLCK   + EA +LF  +       D  + + LIDG CK G L+ A ELF  +    +  DVVTYN ++      G +D A +++ DM +K + P  ++++ L+         ++   +   M  +N+ P
Sbjct:  438 QQGCAMDVVTYNTILHGLCKRKMLGEADKLFNEMTERALFPDSYTLTILIDGHCKLGNLQNAMELFQKMKEKRIRLDVVTYNTLLDGFGKVGDIDTAKEIWADMVSKEILPTPISYSILVNALCSKGHLAEAFRVWDEMISKNIKP 583          

HSP 7 Score: 71.2478 bits (173), Expect = 8.712e-12
Identity = 38/155 (24.52%), Postives = 73/155 (47.10%), Query Frame = 1
Query:   37 AYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAK--GVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            +Y   ++ LC  G++ EA  ++  +     +  +   + +I G C+SG           +     + D ++YN +I+    +  M KA  L   ME +  G+ PD   +N+++ G  R N+  +   +L +M ER V PD ST + +++  V  +
Sbjct:  552 SYSILVNALCSKGHLAEAFRVWDEMISKNIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVREENMSKAFGLVKKMEEEQGGLVPDVFTYNSILHGFCRQNQMKEAEVVLRKMIERGVNPDRSTYTCMINGFVSQD 706          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP381_ARATH (Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=2 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 3.418e-16
Identity = 46/150 (30.67%), Postives = 79/150 (52.67%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            Y T +D L K      AL L+  + +    +D+  Y+ L+DGL K+G L+ A + F  L     + +VVTY  ++  LC  G +  A  +   M  K V P+ V +++++ G ++     + V LL +M+++NV+P+  T   V+D L K
Sbjct:  299 YTTLVDSLFKANIYRHALALYSQMVVRGIPVDLVVYTVLMDGLFKAGDLREAEKTFKMLLEDNQVPNVVTYTALVDGLCKAGDLSSAEFIITQMLEKSVIPNVVTYSSMINGYVKKGMLEEAVSLLRKMEDQNVVPNGFTYGTVIDGLFK 448          

HSP 2 Score: 71.2478 bits (173), Expect = 8.712e-12
Identity = 46/151 (30.46%), Postives = 75/151 (49.67%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRM-----DERNVIPDA 453
            G+  D   Y   +DGL K G + EA + F+ L       ++ +Y+ L+DGLCK+G L  A  +   +    +I +VVTY+ MI+     G +++A  L   ME + V P+   + T++ G  +  +    +EL   M     +E N I DA
Sbjct:  326 GIPVDLVVYTVLMDGLFKAGDLREAEKTFKMLLEDNQVPNVVTYTALVDGLCKAGDLSSAEFIITQMLEKSVIPNVVTYSSMINGYVKKGMLEEAVSLLRKMEDQNVVPNGFTYGTVIDGLFKAGKEEMAIELSKEMRLIGVEENNYILDA 476          

HSP 3 Score: 68.9366 bits (167), Expect = 4.324e-11
Identity = 47/157 (29.94%), Postives = 76/157 (48.41%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCEL--DIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDL 480
            GV  D+  + + I     NG + + + L  + +++ C +  D+ + + LI   CK GRL  A  L   L   V+  D VTYN +I  LC  G  D+A+    +M   G+ PD V++NTL+ G  +     +   L+  + E N+I     LS   +L
Sbjct:   90 GVVPDSRLWNSLIHQFNVNGLVHDQVSLIYS-KMIACGVSPDVFALNVLIHSFCKVGRLSFAISL---LRNRVISIDTVTYNTVISGLCEHGLADEAYQFLSEMVKMGILPDTVSYNTLIDGFCKVGNFVRAKALVDEISELNLITHTILLSSYYNL 242          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP194_ARATH (Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.418e-16
Identity = 46/159 (28.93%), Postives = 85/159 (53.46%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +G + +   + + I+G CK+  +  ALE+   ++ ++ +LD+ +Y  LIDG CK   +K A+ LF  LP   L+ +V  YN +I      GKMD A DL+  M   G++ D   + T++ G +++   +   +L   + +  ++PD     ++V+ L K
Sbjct:  619 NGKSPNVVTFTSLINGFCKSNRMDLALEMTHEMKSMELKLDLPAYGALIDGFCKKNDMKTAYTLFSELPELGLMPNVSVYNSLISGFRNLGKMDAAIDLYKKMVNDGISCDLFTYTTMIDGLLKDGNINLASDLYSELLDLGIVPDEILHMVLVNGLSK 777          

HSP 2 Score: 72.7886 bits (177), Expect = 2.994e-12
Identity = 43/149 (28.86%), Postives = 71/149 (47.65%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            D  AY   IDG CK   +  A  LF  L  L    ++  Y+ LI G    G++  A +L+  +    +  D+ TY  MI  L  DG ++ A DL+ ++   G+ PD +    L+ G  +  +  K  ++L  M +++V P+    S V+
Sbjct:  659 DLPAYGALIDGFCKKNDMKTAYTLFSELPELGLMPNVSVYNSLISGFRNLGKMDAAIDLYKKMVNDGISCDLFTYTTMIDGLLKDGNINLASDLYSELLDLGIVPDEILHMVLVNGLSKKGQFLKASKMLEEMKKKDVTPNVLLYSTVI 807          

HSP 3 Score: 71.633 bits (174), Expect = 6.670e-12
Identity = 40/152 (26.32%), Postives = 75/152 (49.34%), Query Frame = 1
Query:   37 AYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +Y + IDG  K G    A+E +R +       ++ +++ LI+G CKS R+ +A E+ H +    L  D+  Y  +I   C    M  A+ LF ++   G+ P+   +N+L+ G     +    ++L  +M    +  D  T + ++D L+K+
Sbjct:  592 SYNSIIDGFVKVGDTDSAVETYREMSENGKSPNVVTFTSLINGFCKSNRMDLALEMTHEMKSMELKLDLPAYGALIDGFCKKNDMKTAYTLFSELPELGLMPNVSVYNSLISGFRNLGKMDAAIDLYKKMVNDGISCDLFTYTTMIDGLLKD 743          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR95_ARATH (Pentatricopeptide repeat-containing protein At1g62915, mitochondrial OS=Arabidopsis thaliana GN=At1g62915 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 7.614e-16
Identity = 50/158 (31.65%), Postives = 80/158 (50.63%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   DT  + T I GL  +    EA+ L   +    C+ D+ +Y  +++GLCK G   +A  L + +    + A+VV Y+ +I +LC     D A +LF +ME KGV P+ + +++L+         S    LL  M ER + P+  T S ++D  VK
Sbjct:  178 GYKPDTVTFTTLIHGLFLHNKASEAVALIDRMVQRGCQPDLVTYGAVVNGLCKRGDTDLALNLLNKMEAAKIEANVVIYSTVIDSLCKYRHEDDALNLFTEMENKGVRPNVITYSSLISCLCNYGRWSDASRLLSDMIERKINPNLVTFSALIDAFVK 335          

HSP 2 Score: 77.0258 bits (188), Expect = 1.588e-13
Identity = 40/160 (25.00%), Postives = 80/160 (50.00%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +  +  + + Y + I+G C    + EA ++   +    C  ++ +Y+ LI+G CK+ R+    ELF  + +  L+ + VTY  +IH        D A  +F  M + GV P+ + +N L+ G  +N + +K + +   +    + PD  T +I+++ + K
Sbjct:  351 KRSIDPNIFTYSSLINGFCMLDRLGEAKQMLELMIRKDCLPNVVTYNTLINGFCKAKRVDKGMELFREMSQRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSVGVHPNILTYNILLDGLCKNGKLAKAMVVFEYLQRSTMEPDIYTYNIMIEGMCK 510          

HSP 3 Score: 75.8702 bits (185), Expect = 3.537e-13
Identity = 44/151 (29.14%), Postives = 78/151 (51.66%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +   ID   K G +V+A +L+  +     + +I +YS LI+G C   RL  A ++   + R   + +VVTYN +I+  C   ++DK  +LF +M  +G+  + V + TL+ G  +  +      +  +M    V P+  T +I++D L KN
Sbjct:  326 FSALIDAFVKKGKLVKAEKLYEEMIKRSIDPNIFTYSSLINGFCMLDRLGEAKQMLELMIRKDCLPNVVTYNTLINGFCKAKRVDKGMELFREMSQRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSVGVHPNILTYNILLDGLCKN 476          

HSP 4 Score: 75.485 bits (184), Expect = 4.619e-13
Identity = 45/156 (28.85%), Postives = 75/156 (48.08%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + G   D   Y   ++GLCK G    AL L   +   K E ++  YS +ID LCK      A  LF  +    +  +V+TY+ +I  LC  G+   A  L  DM  + + P+ V F+ L+   ++  +  K  +L   M +R++ P+  T S +++
Sbjct:  211 QRGCQPDLVTYGAVVNGLCKRGDTDLALNLLNKMEAAKIEANVVIYSTVIDSLCKYRHEDDALNLFTEMENKGVRPNVITYSSLISCLCNYGRWSDASRLLSDMIERKINPNLVTFSALIDAFVKKGKLVKAEKLYEEMIKRSIDPNIFTYSSLIN 366          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR42_ARATH (Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 7.614e-16
Identity = 47/172 (27.33%), Postives = 84/172 (48.84%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            +HG+  D + Y   I+G  KN  I +A+++F  +   +  ++    S ++   C+ G    A++LF       +  D V YN+   AL   GK+++A +LF +M  KG+APD + + TL+ GC    + S   +L+  MD     PD    +++   L  N ++  +    K
Sbjct:  319 KHGIDPDVYVYSAIIEGHRKNMNIPKAVDVFNKMLKKRKRINCVIVSSILQCYCQMGNFSEAYDLFKEFRETNISLDRVCYNVAFDALGKLGKVEEAIELFREMTGKGIAPDVINYTTLIGGCCLQGKCSDAFDLMIEMDGTGKTPDIVIYNVLAGGLATNGLAQEAFETLK 490          

HSP 2 Score: 81.2629 bits (199), Expect = 8.419e-15
Identity = 46/141 (32.62%), Postives = 68/141 (48.23%), Query Frame = 1
Query:   64 CKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLV 486
            C+ G   EA +LF+  R     LD   Y+   D L K G+++ A ELF  +    +  DV+ Y  +I   C  GK   A DL ++M+  G  PD V +N L  G   N    +  E L  M+ R V P   T ++V++ L+
Sbjct:  372 CQMGNFSEAYDLFKEFRETNISLDRVCYNVAFDALGKLGKVEEAIELFREMTGKGIAPDVINYTTLIGGCCLQGKCSDAFDLMIEMDGTGKTPDIVIYNVLAGGLATNGLAQEAFETLKMMENRGVKPTYVTHNMVIEGLI 512          

HSP 3 Score: 68.9366 bits (167), Expect = 4.324e-11
Identity = 43/150 (28.67%), Postives = 68/150 (45.33%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDAS 456
            R   ++ D   Y    D L K G + EA+ELFR +       D+ +Y+ LI G C  G+   A++L   +       D+V YN++   L  +G   +A +    ME +GV P  V  N ++ G I   E  K       ++ ++   DAS
Sbjct:  388 RETNISLDRVCYNVAFDALGKLGKVEEAIELFREMTGKGIAPDVINYTTLIGGCCLQGKCSDAFDLMIEMDGTGKTPDIVIYNVLAGGLATNGLAQEAFETLKMMENRGVKPTYVTHNMVIEGLIDAGELDKAEAFYESLEHKSRENDAS 537          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP221_ARATH (Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 9.945e-16
Identity = 45/155 (29.03%), Postives = 83/155 (53.55%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            ++G      +Y   I GLCK G   EA    + +     + D+++YS L+ GLC+  ++ +A EL+H   +  L  DV+ +NI+IH LC+ GK+D A  +  +ME +    + V +NTLM G  +  ++++   +   M +  + PD  + + ++
Sbjct:  492 KNGCRPTVVSYNILICGLCKAGKFGEASAFVKEMLENGWKPDLKTYSILLCGLCRDRKIDLALELWHQFLQSGLETDVMMHNILIHGLCSVGKLDDAMTVMANMEHRNCTANLVTYNTLMEGFFKVGDSNRATVIWGYMYKMGLQPDIISYNTIM 646          

HSP 2 Score: 76.6406 bits (187), Expect = 2.074e-13
Identity = 42/156 (26.92%), Postives = 81/156 (51.92%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            D + Y + I GLC  G + +A  +F  L   K  +D+ +Y+ ++ G C+ G++K + EL+  +     + ++V+YNI+I  L  +GK+D+A  ++  M AKG A D   +   + G   N   +K + ++  ++      D    + ++D L K +
Sbjct:  289 DLYTYSSLIHGLCDAGNVDKAESVFNELDERKASIDVVTYNTMLGGFCRCGKIKESLELWRIMEHKNSV-NIVSYNILIKGLLENGKIDEATMIWRLMPAKGYAADKTTYGIFIHGLCVNGYVNKALGVMQEVESSGGHLDVYAYASIIDCLCKKK 443          

HSP 3 Score: 76.2554 bits (186), Expect = 2.708e-13
Identity = 46/162 (28.40%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELF-RTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEI 498
            GVA D   Y   IDG  K      A+EL+ R L       ++++++ +I GL K GR+    +++  + +     D+ TY+ +IH LC  G +DKA  +F +++ +  + D V +NT++ G  R  +  + +EL   M+ +N +   S   ++  LL   +I
Sbjct:  214 GVAPDVTCYNILIDGFLKEKDHKTAMELWDRLLEDSSVYPNVKTHNIMISGLSKCGRVDDCLKIWERMKQNEREKDLYTYSSLIHGLCDAGNVDKAESVFNELDERKASIDVVTYNTMLGGFCRCGKIKESLELWRIMEHKNSVNIVSYNILIKGLLENGKI 375          

HSP 4 Score: 75.485 bits (184), Expect = 4.619e-13
Identity = 46/153 (30.07%), Postives = 74/153 (48.37%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G AAD   Y  FI GLC NGY+ +AL + + +      LD+ +Y+ +ID LCK  RL+ A  L   + +  +  +    N +I  L  D ++ +A     +M   G  P  V++N L+ G  +  +  +    +  M E    PD  T SI++
Sbjct:  389 GYAADKTTYGIFIHGLCVNGYVNKALGVMQEVESSGGHLDVYAYASIIDCLCKKKRLEEASNLVKEMSKHGVELNSHVCNALIGGLIRDSRLGEASFFLREMGKNGCRPTVVSYNILICGLCKAGKFGEASAFVKEMLENGWKPDLKTYSILL 541          

HSP 5 Score: 72.7886 bits (177), Expect = 2.994e-12
Identity = 43/155 (27.74%), Postives = 81/155 (52.26%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            D   Y T + G C+ G I E+LEL+R +   K  ++I SY+ LI GL ++G++  A  ++  +P     AD  TY I IH LC +G ++KA  +  ++E+ G   D  A+ +++    +     +   L+  M +  V  ++   + ++  L+++
Sbjct:  324 DVVTYNTMLGGFCRCGKIKESLELWRIMEH-KNSVNIVSYNILIKGLLENGKIDEATMIWRLMPAKGYAADKTTYGIFIHGLCVNGYVNKALGVMQEVESSGGHLDVYAYASIIDCLCKKKRLEEASNLVKEMSKHGVELNSHVCNALIGGLIRD 477          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP376_ARATH (Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.299e-15
Identity = 46/164 (28.05%), Postives = 80/164 (48.78%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISL 504
            +G   +  +Y T I+ LCK   ++EA  + R +        +R Y+ LIDG C  G+++ A+     + +  +  ++VTYN +I  L   GK+ +A DL L++  KG+ PD   +N+L+ G        + + L   M    + P   T  +++ L  K  I L
Sbjct:  488 NGTMPNVVSYGTLINCLCKGSKLLEAQIVKRDMEDRGVSPKVRIYNMLIDGCCSKGKIEDAFRFSKEMLKKGIELNLVTYNTLIDGLSMTGKLSEAEDLLLEISRKGLKPDVFTYNSLISGYGFAGNVQRCIALYEEMKRSGIKPTLKTYHLLISLCTKEGIEL 651          

HSP 2 Score: 78.1814 bits (191), Expect = 7.127e-14
Identity = 46/152 (30.26%), Postives = 72/152 (47.37%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            Y   I    K   + + LELF  ++  +    +  Y+ LIDGLCK  R+  A +LF  +    L+  ++TYN +I   C  G  +K+  +   M+A  + P  + FNTL+ G  +         +L  M +   +PDA T SI+ D    NE
Sbjct:  182 YGKAIQAAVKLSDVGKGLELFNRMKHDRIYPSVFIYNVLIDGLCKGKRMNDAEQLFDEMLARRLLPSLITYNTLIDGYCKAGNPEKSFKVRERMKADHIEPSLITFNTLLKGLFKAGMVEDAENVLKEMKDLGFVPDAFTFSILFDGYSSNE 333          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP340_ARATH (Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.696e-15
Identity = 45/157 (28.66%), Postives = 81/157 (51.59%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            RR+ +  D ++Y T I G C+   + +ALEL   ++   C   + ++  LID  CK+G++  A      +    L AD+V Y  +I   C  G++D+   LF ++  +G +P  + +NTL+ G  +  +  +  E+   M ER V P+  T + ++D
Sbjct:  169 RRNSLMPDVFSYNTVIRGFCEGKELEKALELANEMKGSGCSWSLVTWGILIDAFCKAGKMDEAMGFLKEMKFMGLEADLVVYTSLIRGFCDCGELDRGKALFDEVLERGDSPCAITYNTLIRGFCKLGQLKEASEIFEFMIERGVRPNVYTYTGLID 325          

HSP 2 Score: 82.4185 bits (202), Expect = 3.779e-15
Identity = 50/191 (26.18%), Postives = 83/191 (43.46%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLM-----LG------------------------------CIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLN 507
            Y   IDG CK G +  A  L   +R+ + +  +  Y+CL+  LCK G L  AW LF  + R     DVV++NIMI      G +  A  L + M   G++PD   ++ L+     LG                              CI   ET K+ EL+ ++ +++++ D      V+D +  +  +++
Sbjct:  497 YTAMIDGFCKTGMLNVAKGLLCKMRVSELQPSVFDYNCLLSSLCKEGSLDQAWRLFEEMQRDNNFPDVVSFNIMIDGSLKAGDIKSAESLLVGMSRAGLSPDLFTYSKLINRFLKLGYLDEAISFFDKMVDSGFEPDAHICDSVLKYCISQGETDKLTELVKKLVDKDIVLDKELTCTVMDYMCNSSANMD 687          

HSP 3 Score: 77.411 bits (189), Expect = 1.216e-13
Identity = 44/156 (28.21%), Postives = 78/156 (50.00%), Query Frame = 1
Query:   22 AADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            A D       ++   K G + +A+EL++ +   K   +  +Y+ +IDG CK+G L +A  L   +    L   V  YN ++ +LC +G +D+A  LF +M+     PD V+FN ++ G ++  +      LL  M    + PD  T S +++  +K
Sbjct:  456 AGDRVTTNILLNSTLKAGDVNKAMELWKQISDSKIVRNSDTYTAMIDGFCKTGMLNVAKGLLCKMRVSELQPSVFDYNCLLSSLCKEGSLDQAWRLFEEMQRDNNFPDVVSFNIMIDGSLKAGDIKSAESLLVGMSRAGLSPDLFTYSKLINRFLK 611          

HSP 4 Score: 77.0258 bits (188), Expect = 1.588e-13
Identity = 45/161 (27.95%), Postives = 82/161 (50.93%), Query Frame = 1
Query:   31 TWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSI 513
            TW     ID  CK G + EA+   + ++ +  E D+  Y+ LI G C  G L     LF  +         +TYN +I   C  G++ +A ++F  M  +GV P+   +  L+ G     +T + ++LL+ M E++  P+A T +I+++ L K+ +  +++
Sbjct:  214 TWGI--LIDAFCKAGKMDEAMGFLKEMKFMGLEADLVVYTSLIRGFCDCGELDRGKALFDEVLERGDSPCAITYNTLIRGFCKLGQLKEASEIFEFMIERGVRPNVYTYTGLIDGLCGVGKTKEALQLLNLMIEKDEEPNAVTYNIIINKLCKDGLVADAV 372          

HSP 5 Score: 74.3294 bits (181), Expect = 1.029e-12
Identity = 46/160 (28.75%), Postives = 82/160 (51.25%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDM--EAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            GV  + + Y   IDGLC  G   EAL+L   +     E +  +Y+ +I+ LCK G +  A E+   + +     D +TYNI++  LCA G +D+A  L   M  ++    PD +++N L+ G  + N   + +++   + E+    D  T +I+++  +K
Sbjct:  312 GVRPNVYTYTGLIDGLCGVGKTKEALQLLNLMIEKDEEPNAVTYNIIINKLCKDGLVADAVEIVELMKKRRTRPDNITYNILLGGLCAKGDLDEASKLLYLMLKDSSYTDPDVISYNALIHGLCKENRLHQALDIYDLLVEKLGAGDRVTTNILLNSTLK 471          

HSP 6 Score: 74.3294 bits (181), Expect = 1.029e-12
Identity = 39/148 (26.35%), Postives = 81/148 (54.73%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIAD--VVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            Y   I+ LCK+G + +A+E+   ++  +   D  +Y+ L+ GLC  G L  A +L + + +     D  V++YN +IH LC + ++ +A D++  +  K  A D V  N L+   ++  + +K +EL  ++ +  ++ ++ T + ++D
Sbjct:  355 YNIIINKLCKDGLVADAVEIVELMKKRRTRPDNITYNILLGGLCAKGDLDEASKLLYLMLKDSSYTDPDVISYNALIHGLCKENRLHQALDIYDLLVEKLGAGDRVTTNILLNSTLKAGDVNKAMELWKQISDSKIVRNSDTYTAMID 502          

HSP 7 Score: 73.9442 bits (180), Expect = 1.344e-12
Identity = 47/152 (30.92%), Postives = 77/152 (50.66%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRM--DERNVIPDASTLSIVVDLLVK 489
            Y T I G CK G + EA E+F  +       ++ +Y+ LIDGLC  G+ K A +L + +       + VTYNI+I+ LC DG +  A ++   M+ +   PD + +N L+ G     +  +  +LL+ M  D     PD  + + ++  L K
Sbjct:  285 YNTLIRGFCKLGQLKEASEIFEFMIERGVRPNVYTYTGLIDGLCGVGKTKEALQLLNLMIEKDEEPNAVTYNIIINKLCKDGLVADAVEIVELMKKRRTRPDNITYNILLGGLCAKGDLDEASKLLYLMLKDSSYTDPDVISYNALIHGLCK 436          

HSP 8 Score: 70.0922 bits (170), Expect = 1.941e-11
Identity = 44/155 (28.39%), Postives = 75/155 (48.39%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            + G A + + +   + GLC+N    +A+ L R +R      D+ SY+ +I G C+   L+ A EL + +        +VT+ I+I A C  GKMD+A     +M+  G+  D V + +L+ G     E  +   L   + ER   P A T + ++
Sbjct:  135 KRGFAFNVYNHNILLKGLCRNLECGKAVSLLREMRRNSLMPDVFSYNTVIRGFCEGKELEKALELANEMKGSGCSWSLVTWGILIDAFCKAGKMDEAMGFLKEMKFMGLEADLVVYTSLIRGFCDCGELDRGKALFDEVLERGDSPCAITYNTLI 289          
The following BLAST results are available for this feature:
BLAST of FC929277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
PP401_ARATH2.617e-1632.88Pentatricopeptide repeat-containing protein At5g28... [more]
PP396_ARATH2.617e-1631.69Pentatricopeptide repeat-containing protein At5g24... [more]
PP360_ARATH2.617e-1631.41Pentatricopeptide repeat-containing protein At5g01... [more]
PP381_ARATH3.418e-1630.67Pentatricopeptide repeat-containing protein At5g14... [more]
PP194_ARATH3.418e-1628.93Pentatricopeptide repeat-containing protein At2g39... [more]
PPR95_ARATH7.614e-1631.65Pentatricopeptide repeat-containing protein At1g62... [more]
PPR42_ARATH7.614e-1627.33Putative pentatricopeptide repeat-containing prote... [more]
PP221_ARATH9.945e-1629.03Pentatricopeptide repeat-containing protein At3g09... [more]
PP376_ARATH1.299e-1528.05Pentatricopeptide repeat-containing protein At5g12... [more]
PP340_ARATH1.696e-1528.66Pentatricopeptide repeat-containing protein At4g28... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DD06RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DD06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929277 ID=FC929277|Name=FC929277|organism=Citrus clementina|type=EST|length=892bp
GGCACGAGGCGTCATGGCGTGGCAGCTGATACCTGGGCATATAGAACCTT
TATTGATGGGCTCTGCAAGAATGGTTATATTGTAGAGGCACTTGAACTAT
TTCGTACTTTGAGAATTCTCAAGTGTGAACTTGATATTCGATCCTACAGC
TGCCTCATTGATGGATTATGTAAATCCGGCAGACTCAAAATTGCATGGGA
ACTATTTCATAGTTTGCCTCGTGGAGTCCTAATAGCAGATGTTGTAACAT
ATAACATCATGATCCATGCGCTTTGTGCTGATGGAAAAATGGACAAGGCA
CATGATTTGTTTCTTGATATGGAAGCAAAAGGTGTAGCACCCGATTGTGT
CGCATTTAACACGCTGATGCTAGGTTGCATCCGCAATAATGAGACATCAA
AAGTTGTTGAACTCCTTCACAGAATGGATGAGAGAAATGTGATACCAGAT
GCATCTACACTTTCAATTGTTGTGGACTTACTTGTAAAGAATGAAATTAG
CTTAAACTCCATTCCACAATTCAAGAGTCAAAGGTAAGTGAGTTTAATAT
TGATTTAGTCGCATGTTTCTTCTGCCTGAAAACCCGATCTGGAGGATCCC
ATTCTTATTAACACGTGTAAAGGAGTGTTGTCTAATGTTGGCATGTTCCT
AGGTTCTGTCCATGGATTCTGTTTGCAGACATGGCTAACTTCTTGTCCAA
CAGATAAGTTTTAAAGTCTTTCAACTTTATGTTGTAAAATAACATTTTCA
TTATTCAATTCATGAGTTTTCCTTCTGTATCACATACTTCTCATTAGCTG
GAAGCGCAAATTTTTAGGCTTTTCCTGTATGGCCTCTTTTTCTGCTCTAA
TAAAATGGCATTTTATTTCCAAAAAAAAAAAAAAAAAAAAAA
back to top