FC929277

Overview
NameFC929277
Unique NameFC929277
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length892
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9258 contig Ccv1_Contig9258:11..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP125_ARATH (Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.696e-15
Identity = 43/153 (28.10%), Postives = 77/153 (50.33%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  +   Y T + G  + G I  A E F  ++   CE+D+ +Y+ ++ G   +G +K A  +F  + R  ++  V TYN MI  LC    ++ A  +F +M  +G  P+   +N L+ G     E S+  EL+ RM+     P+  T ++++
Sbjct:  225 GINPNLTTYNTMLKGFFRAGQIRHAWEFFLEMKKRDCEIDVVTYTTVVHGFGVAGEIKRARNVFDEMIREGVLPSVATYNAMIQVLCKKDNVENAVVMFEEMVRRGYEPNVTTYNVLIRGLFHAGEFSRGEELMQRMENEGCEPNFQTYNMMI 377          

HSP 2 Score: 74.7146 bits (182), Expect = 7.880e-13
Identity = 41/130 (31.54%), Postives = 72/130 (55.38%), Query Frame = 1
Query:   85 EALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            +A++LF  +    C  D+ S++ ++D LCKS R++ A+ELF +L RG    D VTYN++++  C   +  KA ++  +M  +G+ P+   +NT++ G  R  +     E    M +R+   D  T + VV
Sbjct:  144 KAVKLFLNMHEHGCFQDLASFNTILDVLCKSKRVEKAYELFRAL-RGRFSVDTVTYNVILNGWCLIKRTPKALEVLKEMVERGINPNLTTYNTMLKGFFRAGQIRHAWEFFLEMKKRDCEIDVVTYTTVV 272          

HSP 3 Score: 73.9442 bits (180), Expect = 1.344e-12
Identity = 44/171 (25.73%), Postives = 84/171 (49.12%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            HG   D  ++ T +D LCK+  + +A ELFR LR  +  +D  +Y+ +++G C   R   A E+   +    +  ++ TYN M+      G++  A + FL+M+ +    D V + T++ G     E  +   +   M    V+P  +T + ++ +L K +   N++  F+
Sbjct:  155 HGCFQDLASFNTILDVLCKSKRVEKAYELFRALRG-RFSVDTVTYNVILNGWCLIKRTPKALEVLKEMVERGINPNLTTYNTMLKGFFRAGQIRHAWEFFLEMKKRDCEIDVVTYTTVVHGFGVAGEIKRARNVFDEMIREGVLPSVATYNAMIQVLCKKDNVENAVVMFE 324          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP217_ARATH (Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.215e-15
Identity = 48/169 (28.40%), Postives = 90/169 (53.25%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKSQR 534
            D  +Y   I GL K G+  E  ELF +++   C LD R+Y+ +IDG CK G++  A++L   +        VVTY  +I  L    ++D+A+ LF + ++K +  + V +++L+ G  +     +   +L  + ++ + P+  T + ++D LVK E    ++  F+S +
Sbjct:  551 DARSYSILIHGLIKAGFANETYELFYSMKEQGCVLDTRAYNIVIDGFCKCGKVNKAYQLLEEMKTKGFEPTVVTYGSVIDGLAKIDRLDEAYMLFEEAKSKRIELNVVIYSSLIDGFGKVGRIDEAYLILEELMQKGLTPNLYTWNSLLDALVKAEEINEALVCFQSMK 719          

HSP 2 Score: 78.1814 bits (191), Expect = 7.127e-14
Identity = 44/150 (29.33%), Postives = 71/150 (47.33%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            + T I G  K G +  AL L   ++    + DI  Y+  ID   K G++ +AW+ FH +    L  D VTY  MI  LC   ++D+A ++F  +E     P   A+NT+++G     +  +   LL R   +  IP     + ++  L K
Sbjct:  206 FTTLIRGFAKEGRVDSALSLLDEMKSSSLDADIVLYNVCIDSFGKVGKVDMAWKFFHEIEANGLKPDEVTYTSMIGVLCKANRLDEAVEMFEHLEKNRRVPCTYAYNTMIMGYGSAGKFDEAYSLLERQRAKGSIPSVIAYNCILTCLRK 355          

HSP 3 Score: 77.7962 bits (190), Expect = 9.308e-14
Identity = 45/161 (27.95%), Postives = 80/161 (49.69%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +  G   DT AY   IDG CK G + +A +L   ++    E  + +Y  +IDGL K  RL  A+ LF       +  +VV Y+ +I      G++D+A+ +  ++  KG+ P+   +N+L+   ++  E ++ +     M E    P+  T  I+++ L K
Sbjct:  579 KEQGCVLDTRAYNIVIDGFCKCGKVNKAYQLLEEMKTKGFEPTVVTYGSVIDGLAKIDRLDEAYMLFEEAKSKRIELNVVIYSSLIDGFGKVGRIDEAYLILEELMQKGLTPNLYTWNSLLDALVKAEEINEALVCFQSMKELKCTPNQVTYGILINGLCK 739          

HSP 4 Score: 75.8702 bits (185), Expect = 3.537e-13
Identity = 52/162 (32.10%), Postives = 86/162 (53.09%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            R  G      AY   +  L K G + EAL++F  ++      ++ +Y+ LID LC++G+L  A+EL  S+ +  L  +V T NIM+  LC   K+D+A  +F +M+ K   PD + F +L+ G  +       V+  +++ E+ +  D  T SIV   L+KN
Sbjct:  335 RAKGSIPSVIAYNCILTCLRKMGKVDEALKVFEEMK-KDAAPNLSTYNILIDMLCRAGKLDTAFELRDSMQKAGLFPNVRTVNIMVDRLCKSQKLDEACAMFEEMDYKVCTPDEITFCSLIDGLGKVGR----VDDAYKVYEKMLDSDCRTNSIVYTSLIKN 491          

HSP 5 Score: 72.0182 bits (175), Expect = 5.107e-12
Identity = 50/157 (31.85%), Postives = 78/157 (49.68%), Query Frame = 1
Query:   25 ADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDE--RNVIPDASTLSIVVDLLVK 489
            AD   Y   ID   K G +  A + F  +     + D  +Y+ +I  LCK+ RL  A E+F  L +   +     YN MI    + GK D+A+ L     AKG  P  +A+N + L C+R  +  KV E L   +E  ++  P+ ST +I++D+L +
Sbjct:  236 ADIVLYNVCIDSFGKVGKVDMAWKFFHEIEANGLKPDEVTYTSMIGVLCKANRLDEAVEMFEHLEKNRRVPCTYAYNTMIMGYGSAGKFDEAYSLLERQRAKGSIPSVIAYNCI-LTCLR--KMGKVDEALKVFEEMKKDAAPNLSTYNILIDMLCR 389          

HSP 6 Score: 71.633 bits (174), Expect = 6.670e-12
Identity = 41/150 (27.33%), Postives = 72/150 (48.00%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            D     T++D + K G   +   +F  ++  +   D RSYS LI GL K+G     +ELF+S+     + D   YNI+I   C  GK++KA+ L  +M+ KG  P  V + +++ G  + +   +   L      + +  +    S ++D
Sbjct:  516 DLQLLNTYMDCMFKAGEPEKGRAMFEEIKARRFVPDARSYSILIHGLIKAGFANETYELFYSMKEQGCVLDTRAYNIVIDGFCKCGKVNKAYQLLEEMKTKGFEPTVVTYGSVIDGLAKIDRLDEAYMLFEEAKSKRIELNVVIYSSLID 665          

HSP 7 Score: 71.2478 bits (173), Expect = 8.712e-12
Identity = 42/160 (26.25%), Postives = 74/160 (46.25%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            G+  + + + + +D L K   I EAL  F++++ LKC  +  +Y  LI+GLCK  +   A+  +  + +  +    ++Y  MI  L   G + +A  LF   +A G  PD   +N ++ G    N       L      R +     T  +++D L KN+
Sbjct:  687 GLTPNLYTWNSLLDALVKAEEINEALVCFQSMKELKCTPNQVTYGILINGLCKVRKFNKAFVFWQEMQKQGMKPSTISYTTMISGLAKAGNIAEAGALFDRFKANGGVPDSACYNAMIEGLSNGNRAMDAFSLFEETRRRGLPIHNKTCVVLLDTLHKND 846          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP129_ARATH (Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 2.893e-15
Identity = 42/154 (27.27%), Postives = 81/154 (52.60%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            D+  Y   ++G  K   + +A E+FR +    C  DI +YS ++D LCK+GR+  A  +  S+   +       Y++++H    + ++++A D FL+ME  G+  D   FN+L+    + N    V  +L  M  + V P++ + +I++  L++
Sbjct:  236 DSKTYSILLEGWGKEPNLPKAREVFREMIDAGCHPDIVTYSIMVDILCKAGRVDEALGIVRSMDPSICKPTTFIYSVLVHTYGTENRLEEAVDTFLEMERSGMKADVAVFNSLIGAFCKANRMKNVYRVLKEMKSKGVTPNSKSCNIILRHLIE 389          

HSP 2 Score: 69.707 bits (169), Expect = 2.535e-11
Identity = 43/160 (26.88%), Postives = 77/160 (48.12%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            G   D   Y   +D LCK G + EAL + R++    C+     YS L+       RL+ A + F  + R  + ADV  +N +I A C   +M   + +  +M++KGV P+  + N ++   I   E  +  ++  +M  +   PDA T ++V+ +  + +
Sbjct:  267 GCHPDIVTYSIMVDILCKAGRVDEALGIVRSMDPSICKPTTFIYSVLVHTYGTENRLEEAVDTFLEMERSGMKADVAVFNSLIGAFCKANRMKNVYRVLKEMKSKGVTPNSKSCNIILRHLIERGEKDEAFDVFRKM-IKVCEPDADTYTMVIKMFCEKK 425          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP143_ARATH (Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.779e-15
Identity = 43/146 (29.45%), Postives = 80/146 (54.79%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPD 450
            +G+  +  +Y T +D  CK G + +A++ +  +R +    +  +Y+ LID  CK G L  A+ L + + +  +  +VVTY  +I  LC   +M +A +LF  M+  GV P+  ++N L+ G ++     + +ELL+ +  R + PD
Sbjct:  361 NGLKPNVVSYSTLVDAFCKEGMMQQAIKFYVDMRRVGLVPNEYTYTSLIDANCKIGNLSDAFRLGNEMLQVGVEWNVVTYTALIDGLCDAERMKEAEELFGKMDTAGVIPNLASYNALIHGFVKAKNMDRALELLNELKGRGIKPD 506          

HSP 2 Score: 82.0333 bits (201), Expect = 4.935e-15
Identity = 47/164 (28.66%), Postives = 88/164 (53.66%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLG--CIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            RR G+  + + Y + ID  CK G + +A  L   +  +  E ++ +Y+ LIDGLC + R+K A ELF  +    +I ++ +YN +IH       MD+A +L  +++ +G+ PD + + T + G   +   E +KVV  ++ M E  +  ++   + ++D   K+
Sbjct:  394 RRVGLVPNEYTYTSLIDANCKIGNLSDAFRLGNEMLQVGVEWNVVTYTALIDGLCDAERMKEAEELFGKMDTAGVIPNLASYNALIHGFVKAKNMDRALELLNELKGRGIKPDLLLYGTFIWGLCSLEKIEAAKVV--MNEMKECGIKANSLIYTTLMDAYFKS 555          

HSP 3 Score: 76.2554 bits (186), Expect = 2.708e-13
Identity = 44/160 (27.50%), Postives = 80/160 (50.00%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            G+  DT  Y + IDG  K G + + +  F  ++ + CE D+ +Y+ LI+  CK G+L I  E +  +    L  +VV+Y+ ++ A C +G M +A   ++DM   G+ P+   + +L+    +    S    L + M +  V  +  T + ++D L   E
Sbjct:  292 GLVPDTVTYNSMIDGFGKVGRLDDTVCFFEEMKDMCCEPDVITYNALINCFCKFGKLPIGLEFYREMKGNGLKPNVVSYSTLVDAFCKEGMMQQAIKFYVDMRRVGLVPNEYTYTSLIDANCKIGNLSDAFRLGNEMLQVGVEWNVVTYTALIDGLCDAE 451          

HSP 4 Score: 70.4774 bits (171), Expect = 1.486e-11
Identity = 39/154 (25.32%), Postives = 72/154 (46.75%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G     + Y   ID +CK G +  A  LF  ++      D  +Y+ +IDG  K GRL      F  +       DV+TYN +I+  C  GK+    + + +M+  G+ P+ V+++TL+    +     + ++    M    ++P+  T + ++D
Sbjct:  257 GARPTVFTYNIMIDCMCKEGDVEAARGLFEEMKFRGLVPDTVTYNSMIDGFGKVGRLDDTVCFFEEMKDMCCEPDVITYNALINCFCKFGKLPIGLEFYREMKGNGLKPNVVSYSTLVDAFCKEGMMQQAIKFYVDMRRVGLVPNEYTYTSLID 410          

HSP 5 Score: 69.3218 bits (168), Expect = 3.311e-11
Identity = 45/169 (26.63%), Postives = 81/169 (47.93%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQF 522
            GV  +   Y   IDGLC    + EA ELF  +       ++ SY+ LI G  K+  +  A EL + L    +  D++ Y   I  LC+  K++ A  +  +M+  G+  + + + TLM    ++   ++ + LL  M E ++     T  +++D L KN++   ++  F
Sbjct:  432 GVEWNVVTYTALIDGLCDAERMKEAEELFGKMDTAGVIPNLASYNALIHGFVKAKNMDRALELLNELKGRGIKPDLLLYGTFIWGLCSLEKIEAAKVVMNEMKECGIKANSLIYTTLMDAYFKSGNPTEGLHLLDEMKELDIEVTVVTFCVLIDGLCKNKLVSKAVDYF 600          

HSP 6 Score: 68.1662 bits (165), Expect = 7.375e-11
Identity = 43/154 (27.92%), Postives = 73/154 (47.40%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            D   Y   I+  CK G +   LE +R ++    + ++ SYS L+D  CK G ++ A + +  + R  L+ +  TY  +I A C  G +  A  L  +M   GV  + V +  L+ G        +  EL  +MD   VIP+ ++ + ++   VK
Sbjct:  331 DVITYNALINCFCKFGKLPIGLEFYREMKGNGLKPNVVSYSTLVDAFCKEGMMQQAIKFYVDMRRVGLVPNEYTYTSLIDANCKIGNLSDAFRLGNEMLQVGVEWNVVTYTALIDGLCDAERMKEAEELFGKMDTAGVIPNLASYNALIHGFVK 484          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP120_ARATH (Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.779e-15
Identity = 48/158 (30.38%), Postives = 76/158 (48.10%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   D   Y   I GLCKN    EA      +     E D  +Y+ LI G CK G +++A  +         + D  TY  +I  LC +G+ ++A  LF +   KG+ P+ + +NTL+ G        +  +L + M E+ +IP+  T +I+V+ L K
Sbjct:  281 GPKPDVITYNNLIYGLCKNSKFQEAEVYLGKMVNEGLEPDSYTYNTLIAGYCKGGMVQLAERIVGDAVFNGFVPDQFTYRSLIDGLCHEGETNRALALFNEALGKGIKPNVILYNTLIKGLSNQGMILEAAQLANEMSEKGLIPEVQTFNILVNGLCK 438          

HSP 2 Score: 78.9518 bits (193), Expect = 4.178e-14
Identity = 51/159 (32.08%), Postives = 78/159 (49.06%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +G   D + YR+ IDGLC  G    AL LF        + ++  Y+ LI GL   G +  A +L + +    LI +V T+NI+++ LC  G +  A  L   M +KG  PD   FN L+ G     +    +E+L  M +  V PD  T + +++ L K
Sbjct:  350 NGFVPDQFTYRSLIDGLCHEGETNRALALFNEALGKGIKPNVILYNTLIKGLSNQGMILEAAQLANEMSEKGLIPEVQTFNILVNGLCKMGCVSDADGLVKVMISKGYFPDIFTFNILIHGYSTQLKMENALEILDVMLDNGVDPDVYTYNSLLNGLCK 508          

HSP 3 Score: 73.1738 bits (178), Expect = 2.293e-12
Identity = 43/159 (27.04%), Postives = 76/159 (47.80%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            G+  +   +   ++GLCK G + +A  L + +       DI +++ LI G     +++ A E+   +    +  DV TYN +++ LC   K +   + +  M  KG AP+   FN L+    R  +  + + LL  M  ++V PDA T   ++D   KN
Sbjct:  421 GLIPEVQTFNILVNGLCKMGCVSDADGLVKVMISKGYFPDIFTFNILIHGYSTQLKMENALEILDVMLDNGVDPDVYTYNSLLNGLCKTSKFEDVMETYKTMVEKGCAPNLFTFNILLESLCRYRKLDEALGLLEEMKNKSVNPDAVTFGTLIDGFCKN 579          

HSP 4 Score: 71.2478 bits (173), Expect = 8.712e-12
Identity = 41/154 (26.62%), Postives = 76/154 (49.35%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDER-NVIPDASTLSIVV 474
            G   D + +   I G      +  ALE+   +     + D+ +Y+ L++GLCK+ + +   E + ++       ++ T+NI++ +LC   K+D+A  L  +M+ K V PD V F TL+ G  +N +      L  +M+E   V     T +I++
Sbjct:  456 GYFPDIFTFNILIHGYSTQLKMENALEILDVMLDNGVDPDVYTYNSLLNGLCKTSKFEDVMETYKTMVEKGCAPNLFTFNILLESLCRYRKLDEALGLLEEMKNKSVNPDAVTFGTLIDGFCKNGDLDGAYTLFRKMEEAYKVSSSTPTYNIII 609          

HSP 5 Score: 71.2478 bits (173), Expect = 8.712e-12
Identity = 40/156 (25.64%), Postives = 76/156 (48.72%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDM-EAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            +GV  D + Y + ++GLCK     + +E ++T+    C  ++ +++ L++ LC+  +L  A  L   +    +  D VT+  +I   C +G +D A+ LF  M EA  V+     +N ++         +   +L   M +R + PD  T  ++VD
Sbjct:  490 NGVDPDVYTYNSLLNGLCKTSKFEDVMETYKTMVEKGCAPNLFTFNILLESLCRYRKLDEALGLLEEMKNKSVNPDAVTFGTLIDGFCKNGDLDGAYTLFRKMEEAYKVSSSTPTYNIIIHAFTEKLNVTMAEKLFQEMVDRCLGPDGYTYRLMVD 645          

HSP 6 Score: 69.707 bits (169), Expect = 2.535e-11
Identity = 43/157 (27.39%), Postives = 73/157 (46.50%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVV-TYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            G A + + +   ++ LC+   + EAL L   ++      D  ++  LIDG CK+G L  A+ LF  +     ++    TYNI+IHA      +  A  LF +M  + + PD   +  ++ G  +    +   + L  M E   IP  +TL  V++ L
Sbjct:  526 GCAPNLFTFNILLESLCRYRKLDEALGLLEEMKNKSVNPDAVTFGTLIDGFCKNGDLDGAYTLFRKMEEAYKVSSSTPTYNIIIHAFTEKLNVTMAEKLFQEMVDRCLGPDGYTYRLMVDGFCKTGNVNLGYKFLLEMMENGFIPSLTTLGRVINCL 682          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR17_ARATH (Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.935e-15
Identity = 43/143 (30.07%), Postives = 72/143 (50.35%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERN 438
            R GV  DT+ Y T   G C+ G    A ++   +       D+ +++ L+DGLC  G++  A      L +   +  ++TYNI+I  LC   K++ A  LF  +  KGV+PD + + T+M+G  R     +  EL  +M + +
Sbjct:  352 RDGVDGDTFTYNTLYQGYCQAGKFSAAEKVLGRMVSCGVHPDMYTFNILLDGLCDHGKIGKALVRLEDLQKSKTVVGIITYNIIIKGLCKADKVEDAWYLFCSLALKGVSPDVITYITMMIGLRRKRLWREAHELYRKMQKED 494          

HSP 2 Score: 70.8626 bits (172), Expect = 1.138e-11
Identity = 44/169 (26.04%), Postives = 77/169 (45.56%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQF 522
            G++ D +++ T ID  C+   +  AL     +  L  E  I ++  L++G C   R   A  L   +       +VV YN +I +LC  G+++ A D+   M+  G+ PD V +N+L+     +        +L  M    + PD  T S ++D+  K    L +  Q+
Sbjct:  109 GISHDLYSFTTLIDCFCRCARLSLALSCLGKMMKLGFEPSIVTFGSLVNGFCHVNRFYEAMSLVDQIVGLGYEPNVVIYNTIIDSLCEKGQVNTALDVLKHMKKMGIRPDVVTYNSLITRLFHSGTWGVSARILSDMMRMGISPDVITFSALIDVYGKEGQLLEAKKQY 277          

HSP 3 Score: 69.3218 bits (168), Expect = 3.311e-11
Identity = 45/156 (28.85%), Postives = 74/156 (47.44%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            R G++ D   +   ID   K G ++EA + +  +       +I +Y+ LI+GLC  G L  A ++ + L       + VTYN +I+  C   ++D    +   M   GV  D   +NTL  G  +  + S   ++L RM    V PD  T +I++D
Sbjct:  247 RMGISPDVITFSALIDVYGKEGQLLEAKKQYNEMIQRSVNPNIVTYNSLINGLCIHGLLDEAKKVLNVLVSKGFFPNAVTYNTLINGYCKAKRVDDGMKILCVMSRDGVDGDTFTYNTLYQGYCQAGKFSAAEKVLGRMVSCGVHPDMYTFNILLD 402          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP164_ARATH (Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 4.935e-15
Identity = 46/158 (29.11%), Postives = 80/158 (50.63%), Query Frame = 1
Query:    1 GTRRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G + +G+  D  A+  FID LCK G++ EA  +   L++     D  S S +IDG CK G+ + A +L HS     L  ++  Y+  +  +C+ G M +A  +F ++   G+ PDCV + T++ G      T K  +    + +    P  +T +I++
Sbjct:  296 GMKHYGIRPDIVAFTVFIDKLCKAGFLKEATSVLFKLKLFGISQDSVSVSSVIDGFCKVGKPEEAIKLIHSFR---LRPNIFVYSSFLSNICSTGDMLRASTIFQEIFELGLLPDCVCYTTMIDGYCNLGRTDKAFQYFGALLKSGNPPSLTTSTILI 450          

HSP 2 Score: 77.7962 bits (190), Expect = 9.308e-14
Identity = 43/151 (28.48%), Postives = 78/151 (51.66%), Query Frame = 1
Query:   34 WAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLV 486
            + Y +F+  +C  G ++ A  +F+ +  L    D   Y+ +IDG C  GR   A++ F +L +      + T  I+I A    G +  A  +F +M+ +G+  D V +N LM G  + ++ +KV EL+  M    + PD +T +I++  +V
Sbjct:  374 FVYSSFLSNICSTGDMLRASTIFQEIFELGLLPDCVCYTTMIDGYCNLGRTDKAFQYFGALLKSGNPPSLTTSTILIGACSRFGSISDAESVFRNMKTEGLKLDVVTYNNLMHGYGKTHQLNKVFELIDEMRSAGISPDVATYNILIHSMV 524          

HSP 3 Score: 67.781 bits (164), Expect = 9.632e-11
Identity = 39/144 (27.08%), Postives = 75/144 (52.08%), Query Frame = 1
Query:   46 TFIDGLCKN-GYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            T + G C   G I +A  +FR ++    +LD+ +Y+ L+ G  K+ +L   +EL   +    +  DV TYNI+IH++   G +D+A+++  ++  +G  P  +AF  ++ G  +  +  +   L   M +  + PD  T S ++
Sbjct:  447 TILIGACSRFGSISDAESVFRNMKTEGLKLDVVTYNNLMHGYGKTHQLNKVFELIDEMRSAGISPDVATYNILIHSMVVRGYIDEANEIISELIRRGFVPSTLAFTDVIGGFSKRGDFQEAFILWFYMADLRMKPDVVTCSALL 590          

HSP 4 Score: 67.781 bits (164), Expect = 9.632e-11
Identity = 45/151 (29.80%), Postives = 73/151 (48.34%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDAST 459
            R  G++ D   Y   I  +   GYI EA E+   L          +++ +I G  K G  + A+ L+  +    +  DVVT + ++H  C   +M+KA  LF  +   G+ PD V +NTL+ G     +  K  EL+  M +R ++P+ ST
Sbjct:  505 RSAGISPDVATYNILIHSMVVRGYIDEANEIISELIRRGFVPSTLAFTDVIGGFSKRGDFQEAFILWFYMADLRMKPDVVTCSALLHGYCKAQRMEKAIVLFNKLLDAGLKPDVVLYNTLIHGYCSVGDIEKACELIGLMVQRGMLPNEST 655          

HSP 5 Score: 67.781 bits (164), Expect = 9.632e-11
Identity = 42/122 (34.43%), Postives = 64/122 (52.46%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLG 375
            R G    T A+   I G  K G   EA  L+  +  L+ + D+ + S L+ G CK+ R++ A  LF+ L    L  DVV YN +IH  C+ G ++KA +L   M  +G+ P+    + L+LG
Sbjct:  541 RRGFVPSTLAFTDVIGGFSKRGDFQEAFILWFYMADLRMKPDVVTCSALLHGYCKAQRMEKAIVLFNKLLDAGLKPDVVLYNTLIHGYCSVGDIEKACELIGLMVQRGMLPNESTHHALVLG 662          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP445_ARATH (Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.419e-15
Identity = 49/158 (31.01%), Postives = 81/158 (51.27%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            V  D   Y + IDG C++G    A  L   +       D  +Y+ +ID LCKS R++ A +LF SL +  +  +VV Y  +I   C  GK+D+AH +   M +K   P+ + FN L+ G   + +  +   L  +M +  + P  ST +I++  L+K+
Sbjct:  458 VLPDVVTYNSLIDGQCRSGNFDSAYRLLSLMNDRGLVPDQWTYTSMIDSLCKSKRVEEACDLFDSLEQKGVNPNVVMYTALIDGYCKAGKVDEAHLMLEKMLSKNCLPNSLTFNALIHGLCADGKLKEATLLEEKMVKIGLQPTVSTDTILIHRLLKD 615          

HSP 2 Score: 79.7221 bits (195), Expect = 2.449e-14
Identity = 48/166 (28.92%), Postives = 84/166 (50.60%), Query Frame = 1
Query:    1 GTRRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEI 498
            G RR+ VA     Y   I GLC    I EA++LF  ++  +C   +R+Y+ LI  LC S R   A  L   +    +  ++ TY ++I +LC+  K +KA +L   M  KG+ P+ + +N L+ G  +       V+++  M+ R + P+  T + ++    K+ +
Sbjct:  283 GCRRNEVA-----YTHLIHGLCVARRIDEAMDLFVKMKDDECFPTVRTYTVLIKSLCGSERKSEALNLVKEMEETGIKPNIHTYTVLIDSLCSQCKFEKARELLGQMLEKGLMPNVITYNALINGYCKRGMIEDAVDVVELMESRKLSPNTRTYNELIKGYCKSNV 443          

HSP 3 Score: 78.9518 bits (193), Expect = 4.178e-14
Identity = 49/188 (26.06%), Postives = 79/188 (42.02%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKM-----------------------------------DKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  D W Y + ID LCK+  + EA +LF +L       ++  Y+ LIDG CK+G++  A  +   +     + + +T+N +IH LCADGK+                                   D A+  F  M + G  PD   + T +    R        +++ +M E  V PD  T S ++
Sbjct:  492 GLVPDQWTYTSMIDSLCKSKRVEEACDLFDSLEQKGVNPNVVMYTALIDGYCKAGKVDEAHLMLEKMLSKNCLPNSLTFNALIHGLCADGKLKEATLLEEKMVKIGLQPTVSTDTILIHRLLKDGDFDHAYSRFQQMLSSGTKPDAHTYTTFIQTYCREGRLLDAEDMMAKMRENGVSPDLFTYSSLI 679          

HSP 4 Score: 76.6406 bits (187), Expect = 2.074e-13
Identity = 48/179 (26.82%), Postives = 84/179 (46.93%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD------------LLVKNEISLNSIP 516
            G+  +   Y   I+G CK G I +A+++   +   K   + R+Y+ LI G CKS   K    L   L R VL  DVVTYN +I   C  G  D A+ L   M  +G+ PD   + +++    ++    +  +L   ++++ V P+    + ++D            L+++  +S N +P
Sbjct:  388 GLMPNVITYNALINGYCKRGMIEDAVDVVELMESRKLSPNTRTYNELIKGYCKSNVHKAMGVLNKMLERKVL-PDVVTYNSLIDGQCRSGNFDSAYRLLSLMNDRGLVPDQWTYTSMIDSLCKSKRVEEACDLFDSLEQKGVNPNVVMYTALIDGYCKAGKVDEAHLMLEKMLSKNCLP 565          

HSP 5 Score: 72.4034 bits (176), Expect = 3.911e-12
Identity = 40/155 (25.81%), Postives = 76/155 (49.03%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            V  + + Y   ++G CK G + EA +    +     + D  +Y+ LI G C+   L  A+++F+ +P      + V Y  +IH LC   ++D+A DLF+ M+     P    +  L+     +   S+ + L+  M+E  + P+  T ++++D L
Sbjct:  214 VCPNIYTYNKMVNGYCKLGNVEEANQYVSKIVEAGLDPDFFTYTSLIMGYCQRKDLDSAFKVFNEMPLKGCRRNEVAYTHLIHGLCVARRIDEAMDLFVKMKDDECFPTVRTYTVLIKSLCGSERKSEALNLVKEMEETGIKPNIHTYTVLIDSL 368          

HSP 6 Score: 70.0922 bits (170), Expect = 1.941e-11
Identity = 40/154 (25.97%), Postives = 77/154 (50.00%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G+  D + Y + I G C+   +  A ++F  + +  C  +  +Y+ LI GLC + R+  A +LF  +        V TY ++I +LC   +  +A +L  +ME  G+ P+   +  L+       +  K  ELL +M E+ ++P+  T + +++
Sbjct:  248 GLDPDFFTYTSLIMGYCQRKDLDSAFKVFNEMPLKGCRRNEVAYTHLIHGLCVARRIDEAMDLFVKMKDDECFPTVRTYTVLIKSLCGSERKSEALNLVKEMEETGIKPNIHTYTVLIDSLCSQCKFEKARELLGQMLEKGLMPNVITYNALIN 401          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP178_ARATH (Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.419e-15
Identity = 42/153 (27.45%), Postives = 80/153 (52.29%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            +  D ++Y T +D +CK G +  A E+   + + +   ++ SYS +IDG  K+GR   A  LF  +    +  D V+YN ++      G+ ++A D+  +M + G+  D V +N L+ G  +  +  +V ++   M   +V+P+  T S ++D
Sbjct:  370 IEQDVFSYNTLLDAICKGGQMDLAFEILAQMPVKRIMPNVVSYSTVIDGFAKAGRFDEALNLFGEMRYLGIALDRVSYNTLLSIYTKVGRSEEALDILREMASVGIKKDVVTYNALLGGYGKQGKYDEVKKVFTEMKREHVLPNLLTYSTLID 522          

HSP 2 Score: 76.6406 bits (187), Expect = 2.074e-13
Identity = 46/152 (30.26%), Postives = 74/152 (48.68%), Query Frame = 1
Query:   37 AYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +Y T IDG  K G   EAL LF  +R L   LD  SY+ L+    K GR + A ++   +    +  DVVTYN ++      GK D+   +F +M+ + V P+ + ++TL+ G  +     + +E+        +  D    S ++D L KN
Sbjct:  411 SYSTVIDGFAKAGRFDEALNLFGEMRYLGIALDRVSYNTLLSIYTKVGRSEEALDILREMASVGIKKDVVTYNALLGGYGKQGKYDEVKKVFTEMKREHVLPNLLTYSTLIDGYSKGGLYKEAMEIFREFKSAGLRADVVLYSALIDALCKN 562          

HSP 3 Score: 76.2554 bits (186), Expect = 2.708e-13
Identity = 41/156 (26.28%), Postives = 83/156 (53.21%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            +R+GV  D   + + +    + G    A  LF  +   + E D+ SY+ L+D +CK G++ +A+E+   +P   ++ +VV+Y+ +I      G+ D+A +LF +M   G+A D V++NTL+    +   + + +++L  M    +  D  T + ++
Sbjct:  331 QRNGVQPDRITFNSLLAVCSRGGLWEAARNLFDEMTNRRIEQDVFSYNTLLDAICKGGQMDLAFEILAQMPVKRIMPNVVSYSTVIDGFAKAGRFDEALNLFGEMRYLGIALDRVSYNTLLSIYTKVGRSEEALDILREMASVGIKKDVVTYNALL 486          

HSP 4 Score: 68.9366 bits (167), Expect = 4.324e-11
Identity = 36/154 (23.38%), Postives = 77/154 (50.00%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G+A D  +Y T +    K G   EAL++ R +  +  + D+ +Y+ L+ G  K G+     ++F  + R  ++ +++TY+ +I      G   +A ++F + ++ G+  D V ++ L+    +N      V L+  M +  + P+  T + ++D
Sbjct:  439 GIALDRVSYNTLLSIYTKVGRSEEALDILREMASVGIKKDVVTYNALLGGYGKQGKYDEVKKVFTEMKREHVLPNLLTYSTLIDGYSKGGLYKEAMEIFREFKSAGLRADVVLYSALIDALCKNGLVGSAVSLIDEMTKEGISPNVVTYNSIID 592          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR56_ARATH (Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.100e-14
Identity = 50/157 (31.85%), Postives = 79/157 (50.32%), Query Frame = 1
Query:   22 AADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRM-DERNVIPDASTLSIVVDLLVK 489
            A D  +Y T + G  K G  VEA  LF  LR       I +Y+ LIDGLC+SG L+ A  L   +   ++  DV+TY  ++     +G +  A +++ +M  KG+ PD  A+ T  +G +R  ++ K   L   M    +  PD +  ++ +D L K
Sbjct:  371 APDVVSYNTLMHGYIKMGKFVEASLLFDDLRAGDIHPSIVTYNTLIDGLCESGNLEGAQRLKEEMTTQLIFPDVITYTTLVKGFVKNGNLSMATEVYDEMLRKGIKPDGYAYTTRAVGELRLGDSDKAFRLHEEMVATDHHAPDLTIYNVRIDGLCK 527          

HSP 2 Score: 76.6406 bits (187), Expect = 2.074e-13
Identity = 41/151 (27.15%), Postives = 80/151 (52.98%), Query Frame = 1
Query:   22 AADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            A D   Y   IDGLCK G +V+A+E  R +  +    D  +Y+ +I G  ++G+ K+A  L+  + R  L   V+TY ++I+     G++++A     +M+ +GV P+ +  N L+ G  +     +    L +M+E  + P+  + ++++
Sbjct:  512 APDLTIYNVRIDGLCKVGNLVKAIEFQRKIFRVGLVPDHVTYTTVIRGYLENGQFKMARNLYDEMLRKRLYPSVITYFVLIYGHAKAGRLEQAFQYSTEMKKRGVRPNVMTHNALLYGMCKAGNIDEAYRYLCKMEEEGIPPNKYSYTMLI 662          

HSP 3 Score: 70.8626 bits (172), Expect = 1.138e-11
Identity = 47/162 (29.01%), Postives = 75/162 (46.30%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +R  +      Y   I+G  KNG + EA      +R     +   S++ LI+G CK G    AW +   +    +     TYNI I ALC  G++D A +L   M     APD V++NTLM G I+  +  +   L   +   ++ P   T + ++D L ++
Sbjct:  265 KRRNIEFSEVTYNILINGFSKNGKMEEARRFHGDMRRSGFAVTPYSFNPLIEGYCKQGLFDDAWGVTDEMLNAGIYPTTSTYNIYICALCDFGRIDDARELLSSM----AAPDVVSYNTLMHGYIKMGKFVEASLLFDDLRAGDIHPSIVTYNTLIDGLCES 422          

HSP 4 Score: 70.8626 bits (172), Expect = 1.138e-11
Identity = 48/162 (29.63%), Postives = 72/162 (44.44%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            RR G A   +++   I+G CK G   +A  +   +          +Y+  I  LC  GR+  A EL  S+       DVV+YN ++H     GK  +A  LF D+ A  + P  V +NTL+ G   +        L   M  + + PD  T + +V   VKN
Sbjct:  300 RRSGFAVTPYSFNPLIEGYCKQGLFDDAWGVTDEMLNAGIYPTTSTYNIYICALCDFGRIDDARELLSSMAA----PDVVSYNTLMHGYIKMGKFVEASLLFDDLRAGDIHPSIVTYNTLIDGLCESGNLEGAQRLKEEMTTQLIFPDVITYTTLVKGFVKN 457          
The following BLAST results are available for this feature:
BLAST of FC929277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
PP125_ARATH1.696e-1528.10Pentatricopeptide repeat-containing protein At1g74... [more]
PP217_ARATH2.215e-1528.40Pentatricopeptide repeat-containing protein At3g06... [more]
PP129_ARATH2.893e-1527.27Pentatricopeptide repeat-containing protein At1g77... [more]
PP143_ARATH3.779e-1529.45Putative pentatricopeptide repeat-containing prote... [more]
PP120_ARATH3.779e-1530.38Putative pentatricopeptide repeat-containing prote... [more]
PPR17_ARATH4.935e-1530.07Pentatricopeptide repeat-containing protein At1g06... [more]
PP164_ARATH4.935e-1529.11Pentatricopeptide repeat-containing protein At2g19... [more]
PP445_ARATH8.419e-1531.01Pentatricopeptide repeat-containing protein At5g65... [more]
PP178_ARATH8.419e-1527.45Pentatricopeptide repeat-containing protein At2g31... [more]
PPR56_ARATH1.100e-1431.85Pentatricopeptide repeat-containing protein At1g22... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DD06RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DD06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929277 ID=FC929277|Name=FC929277|organism=Citrus clementina|type=EST|length=892bp
GGCACGAGGCGTCATGGCGTGGCAGCTGATACCTGGGCATATAGAACCTT
TATTGATGGGCTCTGCAAGAATGGTTATATTGTAGAGGCACTTGAACTAT
TTCGTACTTTGAGAATTCTCAAGTGTGAACTTGATATTCGATCCTACAGC
TGCCTCATTGATGGATTATGTAAATCCGGCAGACTCAAAATTGCATGGGA
ACTATTTCATAGTTTGCCTCGTGGAGTCCTAATAGCAGATGTTGTAACAT
ATAACATCATGATCCATGCGCTTTGTGCTGATGGAAAAATGGACAAGGCA
CATGATTTGTTTCTTGATATGGAAGCAAAAGGTGTAGCACCCGATTGTGT
CGCATTTAACACGCTGATGCTAGGTTGCATCCGCAATAATGAGACATCAA
AAGTTGTTGAACTCCTTCACAGAATGGATGAGAGAAATGTGATACCAGAT
GCATCTACACTTTCAATTGTTGTGGACTTACTTGTAAAGAATGAAATTAG
CTTAAACTCCATTCCACAATTCAAGAGTCAAAGGTAAGTGAGTTTAATAT
TGATTTAGTCGCATGTTTCTTCTGCCTGAAAACCCGATCTGGAGGATCCC
ATTCTTATTAACACGTGTAAAGGAGTGTTGTCTAATGTTGGCATGTTCCT
AGGTTCTGTCCATGGATTCTGTTTGCAGACATGGCTAACTTCTTGTCCAA
CAGATAAGTTTTAAAGTCTTTCAACTTTATGTTGTAAAATAACATTTTCA
TTATTCAATTCATGAGTTTTCCTTCTGTATCACATACTTCTCATTAGCTG
GAAGCGCAAATTTTTAGGCTTTTCCTGTATGGCCTCTTTTTCTGCTCTAA
TAAAATGGCATTTTATTTCCAAAAAAAAAAAAAAAAAAAAAA
back to top