FC929277

Overview
NameFC929277
Unique NameFC929277
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length892
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9258 contig Ccv1_Contig9258:11..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR18_ARATH (Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.708e-13
Identity = 51/165 (30.91%), Postives = 79/165 (47.88%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN---EISLNSIPQFK 525
            Y   IDGLCK G + EA E+   +        + +YS LID   K  R  +A ++   +       +VV Y  MI  LC  GK D+A+ L   ME KG  P+ V +  ++ G     +    +ELL RM  + V P+  T  +++D   KN   +++ N + + K
Sbjct:  677 YDALIDGLCKVGKLDEAQEVKTEMSEHGFPATLYTYSSLIDRYFKVKRQDLASKVLSKMLENSCAPNVVIYTEMIDGLCKVGKTDEAYKLMQMMEEKGCQPNVVTYTAMIDGFGMIGKIETCLELLERMGSKGVAPNYVTYRVLIDHCCKNGALDVAHNLLEEMK 841          

HSP 2 Score: 75.0998 bits (183), Expect = 6.033e-13
Identity = 43/154 (27.92%), Postives = 76/154 (49.35%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            GV  +     +F   LC  G   +A  + R +       D  +YS +++ LC + ++++A+ LF  + RG L+ADV TY IM+ + C  G +++A   F +M   G  P+ V +  L+   ++  + S   EL   M     +P+  T S ++D
Sbjct:  443 GVVLNKINVSSFTRCLCSAGKYEKAFSVIREMIGQGFIPDTSTYSKVLNYLCNASKMELAFLLFEEMKRGGLVADVYTYTIMVDSFCKAGLIEQARKWFNEMREVGCTPNVVTYTALIHAYLKAKKVSYANELFETMLSEGCLPNIVTYSALID 596          

HSP 3 Score: 70.4774 bits (171), Expect = 1.486e-11
Identity = 45/177 (25.42%), Postives = 83/177 (46.89%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLF-----------LDMEAK-----GVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +R G+ AD + Y   +D  CK G I +A + F  +R + C  ++ +Y+ LI    K+ ++  A ELF ++     + ++VTY+ +I   C  G+++KA  +F           +DM  K        P+ V +  L+ G  +++   +  +LL  M      P+      ++D L K
Sbjct:  510 KRGGLVADVYTYTIMVDSFCKAGLIEQARKWFNEMREVGCTPNVVTYTALIHAYLKAKKVSYANELFETMLSEGCLPNIVTYSALIDGHCKAGQVEKACQIFERMCGSKDVPDVDMYFKQYDDNSERPNVVTYGALLDGFCKSHRVEEARKLLDAMSMEGCEPNQIVYDALIDGLCK 686          

HSP 4 Score: 68.1662 bits (165), Expect = 7.375e-11
Identity = 39/145 (26.90%), Postives = 71/145 (48.97%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPD 450
            G   DT  Y   ++ LC    +  A  LF  ++      D+ +Y+ ++D  CK+G ++ A + F+ +       +VVTY  +IHA     K+  A++LF  M ++G  P+ V ++ L+ G  +  +  K  ++  RM     +PD
Sbjct:  478 GFIPDTSTYSKVLNYLCNASKMELAFLLFEEMKRGGLVADVYTYTIMVDSFCKAGLIEQARKWFNEMREVGCTPNVVTYTALIHAYLKAKKVSYANELFETMLSEGCLPNIVTYSALIDGHCKAGQVEKACQIFERMCGSKDVPD 622          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP275_ARATH (Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.708e-13
Identity = 44/159 (27.67%), Postives = 76/159 (47.80%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSG-RLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G+  D   +   + G    G + +A +L   +R    E ++  Y+ LI  LC++  R+  A  +F  + R    AD+VTY  +I   C  G +DK + +  DM  KGV P  V +  +M+   +  +  + +EL+ +M  R   PD    ++V+ L  K
Sbjct:  266 GLEPDIVVFTNLLSGYAHAGKMADAYDLMNDMRKRGFEPNVNCYTVLIQALCRTEKRMDEAMRVFVEMERYGCEADIVTYTALISGFCKWGMIDKGYSVLDDMRKKGVMPSQVTYMQIMVAHEKKEQFEECLELIEKMKRRGCHPDLLIYNVVIRLACK 424          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP199_ARATH (Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.537e-13
Identity = 44/145 (30.34%), Postives = 70/145 (48.28%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNV 441
            R+  V AD+  +   I G C+     EA+   + +  L   L    YS ++    K G++  A  +F+ +       DV+ Y  M+HA  A  K  KA +LFL+MEA G+ PD +A + LM    +  + S V  L+  M E+ +
Sbjct:  522 RKKKVKADSVTFTILISGSCRMSKYPEAISYLKEMEDLSIPLTKEVYSSVLCAYSKQGQVTEAESIFNQMKMAGCEPDVIAYTSMLHAYNASEKWGKACELFLEMEANGIEPDSIACSALMRAFNKGGQPSNVFVLMDLMREKEI 666          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR67_ARATH (Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.033e-13
Identity = 44/153 (28.76%), Postives = 75/153 (49.02%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G++ +   Y   I GLC++G I EA  ++  +     E  I +YS LIDG CK G L+  + L+  + +     DVV Y +++  L   G M  A    + M  + +  + V FN+L+ G  R N   + +++   M    + PD +T + V+
Sbjct:  386 GISPNVVTYTILIKGLCQDGRIYEAFGMYGQILKRGMEPSIVTYSSLIDGFCKCGNLRSGFALYEDMIKMGYPPDVVIYGVLVDGLSKQGLMLHAMRFSVKMLGQSIRLNVVVFNSLIDGWCRLNRFDEALKVFRLMGIYGIKPDVATFTTVM 538          

HSP 2 Score: 69.707 bits (169), Expect = 2.535e-11
Identity = 52/201 (25.87%), Postives = 89/201 (44.28%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELF-HSLPRGV----------------------------------LIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSI 513
            G A +   + T I+G CK G +  A +LF+ +     E D+ +YS LIDG  K+G L +  +LF  +L +GV                                  +  +VVTY I+I  LC DG++ +A  ++  +  +G+ P  V +++L+ G  +         L   M +    PD     ++VD L K  + L+++
Sbjct:  281 GPAPNVVTFCTLINGFCKRGEMDRAFDLFKVMEQRGIEPDLIAYSTLIDGYFKAGMLGMGHKLFSQALHKGVKLDVVVFSSTIDVYVKSGDLATASVVYKRMLCQGISPNVVTYTILIKGLCQDGRIYEAFGMYGQILKRGMEPSIVTYSSLIDGFCKCGNLRSGFALYEDMIKMGYPPDVVIYGVLVDGLSKQGLMLHAM 481          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR22_ARATH (Pentatricopeptide repeat-containing protein At1g08610 OS=Arabidopsis thaliana GN=At1g08610 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.033e-13
Identity = 41/149 (27.52%), Postives = 75/149 (50.34%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDAST 459
            HG+  +T  Y T +  LC + Y  E  E+   +        + +Y+ LI+GLCK+  L  A + F+ +     + D+VTYN ++ A+  +G +D A +L   ++     P  + +N+++ G  +     K +EL H+M +  + PD  T
Sbjct:  308 HGLELNTVTYNTLLHSLCSHEYWDEVEEILNIMYQTSYCPTVITYNILINGLCKARLLSRAIDFFYQMLEQKCLPDIVTYNTVLGAMSKEGMVDDAIELLGLLKNTCCPPGLITYNSVIDGLAKKGLMKKALELYHQMLDAGIFPDDIT 456          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP152_ARATH (Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.033e-13
Identity = 44/160 (27.50%), Postives = 78/160 (48.75%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            G+    + Y + I  LC+     EA ELF  +     + D+   + L+DG C  G +  A+ L   +    +  D VTYN ++  LC +GK ++A +L  +M+ +G+ PD +++NTL+ G  +  +T     +   M      P   T + ++  L KN+
Sbjct:  427 GIQPTQFTYTSLIYVLCRKNKTREADELFEKVVGKGMKPDLVMMNTLMDGHCAIGNMDRAFSLLKEMDMMSINPDDVTYNCLMRGLCGEGKFEEARELMGEMKRRGIKPDHISYNTLISGYSKKGDTKHAFMVRDEMLSLGFNPTLLTYNALLKGLSKNQ 586          

HSP 2 Score: 73.9442 bits (180), Expect = 1.344e-12
Identity = 48/155 (30.97%), Postives = 71/155 (45.81%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            + G+    + Y T I GL     I  A  L R +R     LD  +Y+ LI+G C+ G  K A+ L   +    +     TY  +I+ LC   K  +A +LF  +  KG+ PD V  NTLM G        +   LL  MD  ++ PD  T + ++
Sbjct:  355 KQGMVPTFYTYNTLIHGLFMENKIEAAEILIREIREKGIVLDSVTYNILINGYCQHGDAKKAFALHDEMMTDGIQPTQFTYTSLIYVLCRKNKTREADELFEKVVGKGMKPDLVMMNTLMDGHCAIGNMDRAFSLLKEMDMMSINPDDVTYNCLM 509          

HSP 3 Score: 73.1738 bits (178), Expect = 2.293e-12
Identity = 42/156 (26.92%), Postives = 73/156 (46.79%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            G+  D     T +DG C  G +  A  L + + ++    D  +Y+CL+ GLC  G+ + A EL   + R  +  D ++YN +I      G    A  +  +M + G  P  + +N L+ G  +N E     ELL  M    ++P+ S+   V++ +
Sbjct:  462 GMKPDLVMMNTLMDGHCAIGNMDRAFSLLKEMDMMSINPDDVTYNCLMRGLCGEGKFEEARELMGEMKRRGIKPDHISYNTLISGYSKKGDTKHAFMVRDEMLSLGFNPTLLTYNALLKGLSKNQEGELAEELLREMKSEGIVPNDSSFCSVIEAM 617          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR50_ARATH (Putative pentatricopeptide repeat-containing protein At1g19290 OS=Arabidopsis thaliana GN=At1g19290 PE=3 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 7.880e-13
Identity = 41/153 (26.80%), Postives = 77/153 (50.33%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            GV+ +   Y + I G CK G + EA  +F  L+  K   D   Y  L+DG C++G+++ A  +  ++    +  +    N +I+  C  G++ +A  +F  M    + PD   +NTL+ G  R     + ++L  +M ++ V+P   T +I++
Sbjct:  291 GVSRNVVTYTSLIKGYCKKGLMEEAEHVFELLKEKKLVADQHMYGVLMDGYCRTGQIRDAVRVHDNMIEIGVRTNTTICNSLINGYCKSGQLVEAEQIFSRMNDWSLKPDHHTYNTLVDGYCRAGYVDEALKLCDQMCQKEVVPTVMTYNILL 443          

HSP 2 Score: 74.3294 bits (181), Expect = 1.029e-12
Identity = 42/160 (26.25%), Postives = 84/160 (52.50%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            GV  +T    + I+G CK+G +VEA ++F  +     + D  +Y+ L+DG C++G +  A +L   + +  ++  V+TYNI++      G       L+  M  +GV  D ++ +TL+    +  + ++ ++L   +  R ++ D  TL++++  L K E
Sbjct:  361 GVRTNTTICNSLINGYCKSGQLVEAEQIFSRMNDWSLKPDHHTYNTLVDGYCRAGYVDEALKLCDQMCQKEVVPTVMTYNILLKGYSRIGAFHDVLSLWKMMLKRGVNADEISCSTLLEALFKLGDFNEAMKLWENVLARGLLTDTITLNVMISGLCKME 520          

HSP 3 Score: 73.9442 bits (180), Expect = 1.344e-12
Identity = 45/161 (27.95%), Postives = 84/161 (52.17%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCEL-DIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDA---STLSIVVDLLVKNEISLNS 510
            Y   I GLCK G + +A +LF  L      + D  +Y+ LI G   +G +  A+ L   +    +I ++VTYN +I  LC  G +D+A  L   +  KG+ P+ + +NTL+ G +++   ++ + L  +M E+ ++  +     + I  ++++  E+ L S
Sbjct:  722 YNVAIAGLCKAGKLEDARKLFSDLLSSDRFIPDEYTYTILIHGCAIAGDINKAFTLRDEMALKGIIPNIVTYNALIKGLCKLGNVDRAQRLLHKLPQKGITPNAITYNTLIDGLVKSGNVAEAMRLKEKMIEKGLVRGSDKQGDVDIPKEVVLDPEVKLGS 882          

HSP 4 Score: 68.1662 bits (165), Expect = 7.375e-11
Identity = 46/157 (29.30%), Postives = 74/157 (47.13%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            + AD   Y   +DG C+ G I +A+ +   +  +    +    + LI+G CKSG+L  A ++F  +    L  D  TYN ++   C  G +D+A  L   M  K V P  + +N L+ G  R      V+ L   M +R V  D  + S +++ L K
Sbjct:  327 LVADQHMYGVLMDGYCRTGQIRDAVRVHDNMIEIGVRTNTTICNSLINGYCKSGQLVEAEQIFSRMNDWSLKPDHHTYNTLVDGYCRAGYVDEALKLCDQMCQKEVVPTVMTYNILLKGYSRIGAFHDVLSLWKMMLKRGVNADEISCSTLLEALFK 483          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP236_ARATH (Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 7.880e-13
Identity = 56/210 (26.67%), Postives = 93/210 (44.29%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKSQRXXXXXXXXXXXXXA*KPDLEDPILINTCKGVLSNVGMF 648
            V+   + Y   IDG CK   + +AL L   +          +Y  LI+ L K+ R + A ELF  L           Y +MI      GK+ +A DLF +M+ +G  PD  A+N LM G ++    ++   LL +M+E     D ++ +I+++   +  +   +I  F++ +               KP   D +  NT  G  ++ GMF
Sbjct:  405 VSPSEFTYSILIDGYCKTNRVEKALLLLEEMDEKGFPPCPAAYCSLINALGKAKRYEAANELFKELKENFGNVSSRVYAVMIKHFGKCGKLSEAVDLFNEMKNQGSGPDVYAYNALMSGMVKAGMINEANSLLRKMEENGCRADINSHNIILNGFARTGVPRRAIEMFETIKHSGI-----------KP---DGVTYNTLLGCFAHAGMF 600          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PP392_ARATH (Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.029e-12
Identity = 36/161 (22.36%), Postives = 81/161 (50.31%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            + G++ D   +   I+G C+ G +  A ++   ++   C  ++ +YS L++G CK G+++ A + F  + +  L  D V Y  +++  C +G+ D+A  L  +M+A     D + +N ++ G      + + +++L +     V  +  +  I+++ L  N
Sbjct:  261 KEGISPDPVTFNVMINGFCRAGEVERAKKILDFMKKNGCNPNVYNYSALMNGFCKVGKIQEAKQTFDEVKKTGLKLDTVGYTTLMNCFCRNGETDEAMKLLGEMKASRCRADTLTYNVILRGLSSEGRSEEALQMLDQWGSEGVHLNKGSYRIILNALCCN 421          

HSP 2 Score: 69.707 bits (169), Expect = 2.535e-11
Identity = 39/156 (25.00%), Postives = 79/156 (50.64%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            +++G   + + Y   ++G CK G I EA + F  ++    +LD   Y+ L++  C++G    A +L   +      AD +TYN+++  L ++G+ ++A  +     ++GV  +  ++  ++     N E  K V+ L  M ER + P  +T + +V
Sbjct:  295 KKNGCNPNVYNYSALMNGFCKVGKIQEAKQTFDEVKKTGLKLDTVGYTTLMNCFCRNGETDEAMKLLGEMKASRCRADTLTYNVILRGLSSEGRSEEALQMLDQWGSEGVHLNKGSYRIILNALCCNGELEKAVKFLSVMSERGIWPHHATWNELV 450          
BLAST of FC929277 vs. ExPASy Swiss-Prot
Match: PPR41_ARATH (Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=3 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.344e-12
Identity = 43/145 (29.66%), Postives = 75/145 (51.72%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            Y T +DGLC+   + +A+   RT         + S++ ++ G CK G + +A   F ++ +  L+  V ++NI+I+ LC  G + +A +L  DM   GV PD V +N L  G       S   E++  M ++ + PD  T +I++
Sbjct:  204 YSTVVDGLCRQQKLEDAVLFLRTSEWKDIGPSVVSFNSIMSGYCKLGFVDMAKSFFCTVLKCGLVPSVYSHNILINGLCLVGSIAEALELASDMNKHGVEPDSVTYNILAKGFHLLGMISGAWEVIRDMLDKGLSPDVITYTILL 348          

HSP 2 Score: 70.8626 bits (172), Expect = 1.138e-11
Identity = 51/171 (29.82%), Postives = 80/171 (46.78%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELD-IRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            G++ D   Y   + G C+ G I   L L + +     EL+ I   S ++ GLCK+GR+  A  LF+ +    L  D+V Y+I+IH LC  GK D A  L+ +M  K + P+      L+LG  +     +   LL  +       D    +IV+D   K+     ++  FK
Sbjct:  336 GLSPDVITYTILLCGQCQLGNIDMGLVLLKDMLSRGFELNSIIPCSVMLSGLCKTGRIDEALSLFNQMKADGLSPDLVAYSIVIHGLCKLGKFDMALWLYDEMCDKRILPNSRTHGALLLGLCQKGMLLEARSLLDSLISSGETLDIVLYNIVIDGYAKSGCIEEALELFK 506          

HSP 3 Score: 67.781 bits (164), Expect = 9.632e-11
Identity = 42/138 (30.43%), Postives = 67/138 (48.55%), Query Frame = 1
Query:   58 GLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIV 471
            GLC+ G ++EA  L  +L      LDI  Y+ +IDG  KSG ++ A ELF  +    +   V T+N +I+  C    + +A  +   ++  G+AP  V++ TLM        T  + EL   M    + P   T S++
Sbjct:  456 GLCQKGMLLEARSLLDSLISSGETLDIVLYNIVIDGYAKSGCIEEALELFKVVIETGITPSVATFNSLIYGYCKTQNIAEARKILDVIKLYGLAPSVVSYTTLMDAYANCGNTKSIDELRREMKAEGIPPTNVTYSVI 593          
The following BLAST results are available for this feature:
BLAST of FC929277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
PPR18_ARATH2.708e-1330.91Pentatricopeptide repeat-containing protein At1g06... [more]
PP275_ARATH2.708e-1327.67Pentatricopeptide repeat-containing protein At3g49... [more]
PP199_ARATH3.537e-1330.34Pentatricopeptide repeat-containing protein At2g41... [more]
PPR67_ARATH6.033e-1328.76Putative pentatricopeptide repeat-containing prote... [more]
PPR22_ARATH6.033e-1327.52Pentatricopeptide repeat-containing protein At1g08... [more]
PP152_ARATH6.033e-1327.50Pentatricopeptide repeat-containing protein At2g15... [more]
PPR50_ARATH7.880e-1326.80Putative pentatricopeptide repeat-containing prote... [more]
PP236_ARATH7.880e-1326.67Pentatricopeptide repeat-containing protein At3g16... [more]
PP392_ARATH1.029e-1222.36Pentatricopeptide repeat-containing protein At5g18... [more]
PPR41_ARATH1.344e-1229.66Putative pentatricopeptide repeat-containing prote... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DD06RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DD06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929277 ID=FC929277|Name=FC929277|organism=Citrus clementina|type=EST|length=892bp
GGCACGAGGCGTCATGGCGTGGCAGCTGATACCTGGGCATATAGAACCTT
TATTGATGGGCTCTGCAAGAATGGTTATATTGTAGAGGCACTTGAACTAT
TTCGTACTTTGAGAATTCTCAAGTGTGAACTTGATATTCGATCCTACAGC
TGCCTCATTGATGGATTATGTAAATCCGGCAGACTCAAAATTGCATGGGA
ACTATTTCATAGTTTGCCTCGTGGAGTCCTAATAGCAGATGTTGTAACAT
ATAACATCATGATCCATGCGCTTTGTGCTGATGGAAAAATGGACAAGGCA
CATGATTTGTTTCTTGATATGGAAGCAAAAGGTGTAGCACCCGATTGTGT
CGCATTTAACACGCTGATGCTAGGTTGCATCCGCAATAATGAGACATCAA
AAGTTGTTGAACTCCTTCACAGAATGGATGAGAGAAATGTGATACCAGAT
GCATCTACACTTTCAATTGTTGTGGACTTACTTGTAAAGAATGAAATTAG
CTTAAACTCCATTCCACAATTCAAGAGTCAAAGGTAAGTGAGTTTAATAT
TGATTTAGTCGCATGTTTCTTCTGCCTGAAAACCCGATCTGGAGGATCCC
ATTCTTATTAACACGTGTAAAGGAGTGTTGTCTAATGTTGGCATGTTCCT
AGGTTCTGTCCATGGATTCTGTTTGCAGACATGGCTAACTTCTTGTCCAA
CAGATAAGTTTTAAAGTCTTTCAACTTTATGTTGTAAAATAACATTTTCA
TTATTCAATTCATGAGTTTTCCTTCTGTATCACATACTTCTCATTAGCTG
GAAGCGCAAATTTTTAGGCTTTTCCTGTATGGCCTCTTTTTCTGCTCTAA
TAAAATGGCATTTTATTTCCAAAAAAAAAAAAAAAAAAAAAA
back to top