FC929324
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC929324 vs. ExPASy Swiss-Prot
Match: CDK2_CARAU (Cell division protein kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 1.934e-14 Identity = 38/50 (76.00%), Postives = 44/50 (88.00%), Query Frame = 1 Query: 226 YEKVEKIGEGTYGVVYKARNCVTNETISLKKIRREQEDEGVPSTAIIEIS 375 ++KVEKIGEGTYGVVYKA+N VT ET++LKKIR + E EGVPSTAI EIS Sbjct: 4 FQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREIS 53
BLAST of FC929324 vs. ExPASy Swiss-Prot
Match: CDK2_HUMAN (Cell division protein kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2) HSP 1 Score: 75.8702 bits (185), Expect = 7.348e-14 Identity = 37/50 (74.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 226 YEKVEKIGEGTYGVVYKARNCVTNETISLKKIRREQEDEGVPSTAIIEIS 375 ++KVEKIGEGTYGVVYKARN +T E ++LKKIR + E EGVPSTAI EIS Sbjct: 4 FQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREIS 53
BLAST of FC929324 vs. ExPASy Swiss-Prot
Match: CDC2_DROME (Cell division control protein 2 homolog OS=Drosophila melanogaster GN=cdc2 PE=1 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 7.348e-14 Identity = 35/50 (70.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 226 YEKVEKIGEGTYGVVYKARNCVTNETISLKKIRREQEDEGVPSTAIIEIS 375 +EK+EKIGEGTYGVVYK RN +T + +++KKIR E +DEGVPSTAI EIS Sbjct: 4 FEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREIS 53
BLAST of FC929324 vs. ExPASy Swiss-Prot
Match: CDK2_RAT (Cell division protein kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=2 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.637e-13 Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 226 YEKVEKIGEGTYGVVYKARNCVTNETISLKKIRREQEDEGVPSTAIIEIS 375 ++KVEKIGEGTYGVVYKA+N +T E ++LKKIR + E EGVPSTAI EIS Sbjct: 4 FQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREIS 53
BLAST of FC929324 vs. ExPASy Swiss-Prot
Match: CDK2_MOUSE (Cell division protein kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2) HSP 1 Score: 74.7146 bits (182), Expect = 1.637e-13 Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 226 YEKVEKIGEGTYGVVYKARNCVTNETISLKKIRREQEDEGVPSTAIIEIS 375 ++KVEKIGEGTYGVVYKA+N +T E ++LKKIR + E EGVPSTAI EIS Sbjct: 4 FQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREIS 53
BLAST of FC929324 vs. ExPASy Swiss-Prot
Match: CDK2_MESAU (Cell division protein kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.637e-13 Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 226 YEKVEKIGEGTYGVVYKARNCVTNETISLKKIRREQEDEGVPSTAIIEIS 375 ++KVEKIGEGTYGVVYKA+N +T E ++LKKIR + E EGVPSTAI EIS Sbjct: 4 FQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREIS 53
BLAST of FC929324 vs. ExPASy Swiss-Prot
Match: CDK2_CRIGR (Cell division protein kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.637e-13 Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 226 YEKVEKIGEGTYGVVYKARNCVTNETISLKKIRREQEDEGVPSTAIIEIS 375 ++KVEKIGEGTYGVVYKA+N +T E ++LKKIR + E EGVPSTAI EIS Sbjct: 4 FQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREIS 53
BLAST of FC929324 vs. ExPASy Swiss-Prot
Match: CDK2_BOVIN (Cell division protein kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.637e-13 Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 226 YEKVEKIGEGTYGVVYKARNCVTNETISLKKIRREQEDEGVPSTAIIEIS 375 ++KVEKIGEGTYGVVYKA+N +T E ++LKKIR + E EGVPSTAI EIS Sbjct: 4 FQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREIS 53
BLAST of FC929324 vs. ExPASy Swiss-Prot
Match: CDK5_DICDI (Cell division protein kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2) HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13 Identity = 34/51 (66.67%), Postives = 42/51 (82.35%), Query Frame = 1 Query: 223 KYEKVEKIGEGTYGVVYKARNCVTNETISLKKIRREQEDEGVPSTAIIEIS 375 KY K+EK+GEGTYG+VYKA+N T E ++LK+IR + EDEGVP TAI EIS Sbjct: 3 KYSKIEKLGEGTYGIVYKAKNRETGEIVALKRIRLDSEDEGVPCTAIREIS 53
BLAST of FC929324 vs. ExPASy Swiss-Prot
Match: CDK3_MOUSE (Cell division protein kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2) HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13 Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 226 YEKVEKIGEGTYGVVYKARNCVTNETISLKKIRREQEDEGVPSTAIIEIS 375 ++KVEKIGEGTYGVVYKARN VT + ++LKKIR + E EGVPSTA+ EIS Sbjct: 4 FQKVEKIGEGTYGVVYKARNKVTGQLVALKKIRLDLEAEGVPSTAVREIS 53 The following BLAST results are available for this feature:
BLAST of FC929324 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 67
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC929324 ID=FC929324; Name=FC929324; organism=Citrus clementina; type=EST; length=376bpback to top |