FC929397
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of FC929397 vs. ExPASy Swiss-Prot
Match: LDOX_PERFR (Leucoanthocyanidin dioxygenase OS=Perilla frutescens GN=ANS PE=2 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.501e-14 Identity = 35/70 (50.00%), Postives = 48/70 (68.57%), Query Frame = 3 Query: 3 DQIEILSNGKYKAVLHRTTVNKDKTRMSWPVFLEPPADTVV-GPLPQLVDDENPPKYKAKKFKDYSYCKL 209 D +EILSNGKYK++LHR VNK+K R+SW VF EPP + +V PLP+ V + PP++ + F + KL Sbjct: 279 DTLEILSNGKYKSILHRGLVNKEKVRISWAVFCEPPKEKIVLQPLPETVSEVEPPRFPPRTFAQHLKHKL 348
BLAST of FC929397 vs. ExPASy Swiss-Prot
Match: LDOX_MALDO (Leucoanthocyanidin dioxygenase OS=Malus domestica GN=ANS PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 2.764e-13 Identity = 34/75 (45.33%), Postives = 50/75 (66.67%), Query Frame = 3 Query: 3 DQIEILSNGKYKAVLHRTTVNKDKTRMSWPVFLEPPADTVV-GPLPQLVDDENPPKYKAKKFKDYSYCKLNKLPQ 224 D +EILSNGKYK++LHR VNK+K R+SW VF EPP + ++ PLP+ V ++ P + + F ++ KL + Q Sbjct: 277 DTLEILSNGKYKSILHRGMVNKEKVRISWAVFCEPPKEKIILKPLPETVSEDEPAMFPPRTFAEHIQHKLFRKSQ 351
BLAST of FC929397 vs. ExPASy Swiss-Prot
Match: LDOX_MAIZE (Leucoanthocyanidin dioxygenase OS=Zea mays GN=A2 PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 8.043e-13 Identity = 36/75 (48.00%), Postives = 51/75 (68.00%), Query Frame = 3 Query: 3 DQIEILSNGKYKAVLHRTTVNKDKTRMSWPVFLEPPADTV-VGPLPQLVDDENPPKYKAKKFKDYSYCKLNKLPQ 224 D +EILSNG+Y +VLHR VN++ R+SW VF EPP D+V + PLP+LV + +P ++ + FK + KL K Q Sbjct: 295 DALEILSNGRYTSVLHRGLVNREAVRISWVVFCEPPPDSVLLHPLPELVTEGHPARFTPRTFKQHLDRKLFKKKQ 369 The following BLAST results are available for this feature:
BLAST of FC929397 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC929397 ID=FC929397; Name=FC929397; organism=Citrus clementina; type=EST; length=410bpback to top |