FC929463

Overview
NameFC929463
Unique NameFC929463
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length850
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10223 contig Ccv1_Contig10223:1..847. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX5_ARATH (L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=2 SV=2)

HSP 1 Score: 272.707 bits (696), Expect = 1.808e-72
Identity = 140/240 (58.33%), Postives = 164/240 (68.33%), Query Frame = 3
Query:   99 VSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGF 818
            V  +Y K +EK +R LR  I+ +NCAP+MLR+AWH AGTYD K KTGG  G++R   E     N GL+ AV   E  K + P +SYADLYQLAGVV VEVTGGP IPF PGR D A+   +G LP+  +G  HLR +F ++MGL D+DIVALSGGHTLGR HKERS FEGPWT++PL FDNSYF ELL GE  GLLQL +DKALLDDP F P V+                H KLSELGF
Sbjct:    5 VDAEYLKEIEKTRRDLRALISSRNCAPIMLRLAWHDAGTYDAKKKTGGANGSIRFKEELNRPHNKGLEKAVAFCEEVKAKHPRVSYADLYQLAGVVAVEVTGGPAIPFTPGRKD-ADSADDGELPNPNEGASHLRTLF-SRMGLLDRDIVALSGGHTLGRAHKERSDFEGPWTQDPLKFDNSYFVELLKGETPGLLQLKTDKALLDDPKFHPFVKLYAKDEDMFFKAYAISHKKLSELGF 242          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR_GIBZE (Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae GN=CCP1 PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 3.669e-49
Identity = 117/283 (41.34%), Postives = 158/283 (55.83%), Query Frame = 3
Query:   36 GFASLFLISFSVEKMT-KNYPTVSEDYKKAVEKCKRKL--RGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFG-TMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDK--AEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEK-----------------DGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            G A  +    S    T K +    EDY+K   +   +L  +    + +  P+++R+AWH++GTYD +T TGG  G TMR A E  H AN GL  A   L+P KE+FP I+Y+DL+ LAGV  ++   GP IP+ PGR D+  +    +GRLPDA +  DHLR +FG +MG +D++IVALSG H LGRCH +RSG+ GPWT +P +  N YF  LL  EK                   L+ LPSD AL++D  F+P VEK                L+L ELG
Sbjct:   58 GGAGYYFYGNSASSATAKVFNPSKEDYQKVYNEIAARLEEKDDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLAAARDFLQPVKEKFPWITYSDLWILAGVCAIQEMLGPAIPYRPGRSDRDVSGCTPDGRLPDASKRQDHLRGIFG-RMGFNDQEIVALSGAHALGRCHTDRSGYSGPWTFSPTVLTNDYF-RLLVEEKWQWKKWNGPAQYEDKSTKSLMMLPSDIALIEDKKFKPWVEKYAKDNDAFFKDFSNVVLRLFELG 338          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR2_EMENI (Putative heme-binding peroxidase OS=Emericella nidulans GN=AN5440 PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 4.791e-49
Identity = 111/244 (45.49%), Postives = 138/244 (56.56%), Query Frame = 3
Query:  168 NCAPLMLRIAWHSAGTYDVKTKTGGPFGT-MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGR----DDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGE-----------------------KDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            +  P+ +R+AWHS+GTYD  + TGG  G  MR  AE    AN GL      LEP KE+ P I+Y+DL+ LAGVV +E  GGP IP+ PGR    DD   PP+ GRLPD  QG DHLR +F  +MG +D++IVAL+GGH LGRCH +RSGF+GPW  NP  F N +F  LL  E                       ++ L+ LP+D AL DDP FRP VE+                 KL ELG
Sbjct:   27 SAGPVFVRLAWHSSGTYDAASDTGGSNGAGMRYEAEGGDPANAGLQHGRAFLEPVKEKHPWITYSDLWTLAGVVAIEEMGGPKIPWLPGRTDFVDDSKVPPR-GRLPDGAQGADHLRFIF-YRMGFNDQEIVALAGGHNLGRCHADRSGFQGPWVNNPTRFSNQFFKLLLNMEWKPKTLENGVSQFVYIDPEAEDHEEPLMMLPTDVALRDDPAFRPWVERYAKDKDLFFDHFSKAFAKLIELG 268          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR_CRYNE (Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans GN=CCP1 PE=3 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.067e-48
Identity = 113/261 (43.30%), Postives = 149/261 (57.09%), Query Frame = 3
Query:  105 EDYKKAVEKCKRKLR--GFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGP-FGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDD--KAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTEL---------LTG-------EKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGFAE 824
            ++Y+K   +    L   G+  + + AP++LR+AWHS+GTY+ +  TGG  F TMR   E  HSANNGL +A   +E  K++FP ISY DL+ L GV  V+ +GGP IP+ PGR D  +A+   +GRLPDA Q  DHLR +F  +MG +D++IVALSG H +GRCH  RSGFEGPWT +P+ F N YF  L          TG           L+ LP+D ALL D  F+  V+                  KL ELG  E
Sbjct:  105 DEYQKVYNRIAETLEKEGY-DDGSLAPVLLRLAWHSSGTYNKEDGTGGSNFATMRFKPEAEHSANNGLHVAREHMEKIKQEFPWISYGDLWTLGGVCAVQESGGPTIPWRPGRIDGFEAQVTPDGRLPDASQAQDHLRFIFN-RMGFNDQEIVALSGAHAMGRCHTNRSGFEGPWTFSPVTFSNQYFALLRDEPWQWKKWTGPAQYEDKNTKTLMMLPTDMALLKDKSFKKYVDIYADNEEKFFSDFAKAFSKLIELGVPE 363          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR2_ASPFU (Putative heme-binding peroxidase OS=Aspergillus fumigatus GN=AFUA_6G13570 PE=3 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.394e-48
Identity = 112/244 (45.90%), Postives = 139/244 (56.97%), Query Frame = 3
Query:  168 NCAPLMLRIAWHSAGTYDVKTKTGGPFGT-MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGR----DDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGE-----------------------KDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            +  P+ +R+AWHSAGTYD++T TGG  G  MR  AE    AN GL      LEP KE+ P I+YADL+ LAGVV +E  GGP + + PGR    DD   PP+ GRLPDA QG +HLR VF  +MG +D++IVAL+GGHTLGRCH +RSGF+GPW  NP  F N +F  LLT +                        + L+ LP+D AL  DP FR  V+K                 KL ELG
Sbjct:   27 SAGPVFVRLAWHSAGTYDLETDTGGSNGAGMRYEAEGGDPANAGLQHGRAFLEPVKEKHPWITYADLWTLAGVVAIEALGGPKVVWKPGRTDLVDDSKVPPR-GRLPDATQGAEHLRAVF-YRMGFNDQEIVALAGGHTLGRCHIDRSGFQGPWVNNPTRFSNQFFKLLLTLDWKPKTLPNGISQFVYVDPDAEEGDEPLMMLPTDIALKTDPAFRVWVDKYAADKDLFFDHFAKAFAKLMELG 268          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR_EMENI (Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans GN=ccp1 PE=3 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 5.298e-48
Identity = 112/280 (40.00%), Postives = 151/280 (53.93%), Query Frame = 3
Query:   42 ASLFLISFSVEKMTKNYPTVSEDYKKAVEKCKRKLRGFIA--EKNCAPLMLRIAWHSAGTYDVKTKTGGPFG-TMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDK--AEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEK-----------------DGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            A  +L    V   TK +    EDY+K       +L       + +  P+++R+AWH++GTYD +T TGG  G TMR A E  H AN GL  A   LEP K +FP I+Y+DL+ LAG   ++  GGPDIP+ PGR DK  +    +GRLPDA +  DH+R +FG +MG  D+++VAL G H LGR H +RSGF+GPW  +P +F N +F  LL  EK                   L+  P+D AL+ D  FR  VE+                +KL ELG
Sbjct:   67 AYFYLQGGDVGASTKVFTPTKEDYQKVYNAIAERLANETDYDDGSYGPVLVRLAWHASGTYDAETGTGGSNGATMRFAPESDHGANAGLKYARDFLEPIKAKFPWITYSDLWTLAGACAIQELGGPDIPWRPGRQDKDVSGCTPDGRLPDATKNQDHIRAIFG-RMGFDDREMVALIGAHALGRAHTDRSGFDGPWNFSPTVFTNEFF-RLLVEEKWQPRKWNGPKQFTDNTTKTLMMFPTDLALVQDKGFRKHVERYAKDSDAFFKEFSEVFVKLLELG 344          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR2_YARLI (Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica GN=YALI0D04268g PE=3 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 6.919e-48
Identity = 104/233 (44.64%), Postives = 134/233 (57.51%), Query Frame = 3
Query:  177 PLMLRIAWHSAGTYDVKTKTGGPFG-TMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD---DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLT----------------GEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            P+++R+AWH++GTYD  T TGG  G TMR   E    ANNGL+ A + LEP K +FP I+YADL+ LAGVV +E   GP +P+ PGR    D+   P  GRLPD  QG DHLR +F  +MG +D++IVAL G H +GRCH +RSGFEG W  NP+ F N+YF  L+                  E + L+ LP+D +L+ DP F   VE                  KL ELG
Sbjct:   29 PVLVRLAWHASGTYDKATGTGGSNGATMRYMKEAKDEANNGLENARQFLEPIKAKFPWITYADLWTLAGVVAIEEMDGPKVPWKPGRQDYVDETNVPPNGRLPDGAQGQDHLRDIF-YRMGFNDQEIVALCGAHNMGRCHMDRSGFEGAWVPNPIRFANTYFKLLMNEEWKLTTLKNGVKQYFNEDEELMMLPADYSLMQDPEFHKWVEIYAADKEKFFEDFSKVFAKLIELG 260          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR_NEUCR (Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa GN=ccp-1 PE=3 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 2.629e-47
Identity = 108/238 (45.38%), Postives = 140/238 (58.82%), Query Frame = 3
Query:  177 PLMLRIAWHSAGTYDVKTKTGGPFG-TMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDK--AEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEK-----------------DGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG--FAE 824
            P+++R+AWH++GTYD +T TGG  G TMR A E  H AN GL  A   LEP K +FP I+Y+DL+ L GV  ++   GP IP+ PGR D+  A    +GRLPDA Q  DHLR +F  +MG +D++IVALSG H LGRCH +RSGF+GPWT +P +  N Y+ +LL  EK                   L+ LP+D AL+ D  F+  VEK                +KL ELG  FAE
Sbjct:  111 PVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKAKFPWITYSDLWILGGVCAIQEMLGPQIPYRPGRQDRDAAGCTPDGRLPDASQAQDHLRNIF-YRMGFNDQEIVALSGAHALGRCHADRSGFDGPWTFSPTVLTNDYY-KLLLDEKWQWKKWNGPKQYEDKKTKSLMMLPADMALIQDKKFKQWVEKYAADNELFFKDFSNVIVKLFELGVPFAE 346          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR_ASPFU (Cytochrome c peroxidase, mitochondrial OS=Aspergillus fumigatus GN=ccp1 PE=3 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 3.434e-47
Identity = 112/282 (39.72%), Postives = 154/282 (54.61%), Query Frame = 3
Query:   36 GFASLFLISFSVEKMTKNYPTVSEDYKKAVEKCKRKLRGFIA--EKNCAPLMLRIAWHSAGTYDVKTKTGGPFG-TMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDK--AEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEK-----------------DGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            G  +   ++ S    +K +    EDY+K  +   R+L       + +  P+++R+AWH++GTYD +T TGG  G TMR A E  H AN GL IA   LEP K QFP ISY+DL+ LAG   ++  GGP IP+ PGR DK  A    +GRLPDA +   H+R +F  +MG +D++IVAL G H LGR H +RSG++GPW  +P +F N +F  LL  EK                   L+ LP+D AL+ D  F+  VE+                +KL ELG
Sbjct:   70 GAGAYLYLNGSDSVTSKTFVPGKEDYQKVYDAIARRLADETDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKIARDFLEPIKAQFPWISYSDLWTLAGACAIQELGGPTIPWRPGRQDKDVAACTPDGRLPDASKDQRHIRDIF-YRMGFNDQEIVALIGAHALGRAHPDRSGYDGPWDFSPTVFTNEFF-RLLVDEKWQNRKWNGPAQFTDKTTKTLMMLPADLALIKDKEFKKHVERYARDSDAFFKDFSDAFVKLLELG 349          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR_CRYNV (Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. grubii GN=CCP1 PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 5.857e-47
Identity = 109/261 (41.76%), Postives = 147/261 (56.32%), Query Frame = 3
Query:  105 EDYKKAVEKCKRKL--RGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGP-FGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDD--KAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTEL---------LTG-------EKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGFAE 824
            ++Y+K   +    L   G+  + + AP++LR+AWH++GTY     TGG  F TMR   E  HSANNGL +A   +E  K++FP ISY DL+ L GV  ++ +GGP IP+ PGR D   A+   +GRLPDA Q  DHLR +F  +MG +D++IVALSG H +GRCH  RSGF+GPWT +P+ F N YF  L          TG       +   L+ LP+D AL+ D  F+  V+                  KL ELG  E
Sbjct:  105 DEYQKVYNRIAETLDKEGY-DDGSLAPVLLRLAWHASGTYSKADGTGGSNFATMRFKPEAEHSANNGLHVAREHMEKIKQEFPWISYGDLWTLGGVCAIQESGGPTIPWRPGRIDGYAAQVTPDGRLPDATQAQDHLRFIFN-RMGFNDQEIVALSGAHAMGRCHPNRSGFDGPWTFSPVTFSNQYFALLRDEPWQWKKWTGPAQFEDKKTKTLMMLPTDMALVKDKSFKKYVDIYADNEEKFFSDFAKAFSKLIELGVPE 363          
The following BLAST results are available for this feature:
BLAST of FC929463 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
APX5_ARATH1.808e-7258.33L-ascorbate peroxidase 5, peroxisomal OS=Arabidops... [more]
CCPR_GIBZE3.669e-4941.34Cytochrome c peroxidase, mitochondrial OS=Gibberel... [more]
CCPR2_EMENI4.791e-4945.49Putative heme-binding peroxidase OS=Emericella nid... [more]
CCPR_CRYNE1.067e-4843.30Cytochrome c peroxidase, mitochondrial OS=Cryptoco... [more]
CCPR2_ASPFU1.394e-4845.90Putative heme-binding peroxidase OS=Aspergillus fu... [more]
CCPR_EMENI5.298e-4840.00Cytochrome c peroxidase, mitochondrial OS=Emericel... [more]
CCPR2_YARLI6.919e-4844.64Putative cytochrome c peroxidase, mitochondrial OS... [more]
CCPR_NEUCR2.629e-4745.38Cytochrome c peroxidase, mitochondrial OS=Neurospo... [more]
CCPR_ASPFU3.434e-4739.72Cytochrome c peroxidase, mitochondrial OS=Aspergil... [more]
CCPR_CRYNV5.857e-4741.76Cytochrome c peroxidase, mitochondrial OS=Cryptoco... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2CD08RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2CD08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929463 ID=FC929463; Name=FC929463; organism=Citrus clementina; type=EST; length=850bp
CTCGTGCCTTATTCGGCACGAGGCTCGTTTGTTAAGGATTTGCGTCTCTC
TTTCTCATTTCATTCAGCGTTGAAAAGATGACGAAGAATTACCCCACTGT
TAGCGAGGATTACAAGAAGGCCGTGGAGAAATGCAAGAGGAAGCTCAGAG
GCTTCATCGCTGAGAAGAACTGCGCTCCACTCATGCTCCGTATCGCGTGG
CACTCAGCTGGTACATATGATGTGAAGACCAAGACCGGAGGTCCATTCGG
AACCATGAGGCTCGCTGCTGAGCAGGCACACTCAGCCAACAACGGCCTCG
ATATTGCCGTTAGGCTTTTGGAGCCGTTCAAGGAGCAGTTCCCTACCATC
TCCTACGCTGACCTTTATCAGCTTGCTGGTGTTGTTGGCGTTGAGGTTAC
CGGTGGGCCCGATATCCCCTTCCACCCGGGAAGAGATGACAAGGCTGAGC
CACCTCAAGAAGGCCGGCTTCCTGATGCTAAACAGGGTAATGATCACTTG
AGGCAAGTCTTTGGTGCTCAGATGGGCCTCAGCGACAAGGATATTGTTGC
TCTCTCTGGTGGCCACACCCTGGGAAGGTGCCACAAGGAGAGGTCTGGAT
TTGAGGGACCATGGACCCGCAACCCTCTCATTTTTGACAATTCCTACTTC
ACGGAGCTCTTGACTGGTGAGAAGGATGGTCTTCTGCAATTGCCATCCGA
CAAGGCCCTTCTGGATGACCCTGTTTTCCGCCCTCTTGTTGAGAAATATG
CTGCGGATGAGGACGCTTTCTTCGCTGATTATGCTGAGGCTCATCTCAAG
CTCTCTGAGCTAGGATTTGCTGAAGCCTAATTTAACTGAGTAAATAAATG
back to top