FC929463

Overview
NameFC929463
Unique NameFC929463
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length850
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10223 contig Ccv1_Contig10223:1..847. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APXT_ARATH (L-ascorbate peroxidase T, chloroplastic OS=Arabidopsis thaliana GN=APXT PE=2 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 5.857e-47
Identity = 109/252 (43.25%), Postives = 141/252 (55.95%), Query Frame = 3
Query:  135 KRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKT----GGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEP---PQEGRLPDAKQGN--DHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGP----------------WTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            K  ++  +  K C P+++R+ WH AGTY+   +     GG  G++R  AE  H+AN GL  A++L++P K+++P ISYADL+QLA    +E  GGPDIP   GR D   P   P+EGRLPDA   +  DHLR VF  +MGL DK+IVALSG HTLGR   +RSG+  P                WT   L FDNSYF ++     D LL LP+D AL +DP F+   EK               H KLS LG
Sbjct:   90 KEDIKVLLRTKFCHPILVRLGWHDAGTYNKNIEEWPLRGGANGSLRFEAELKHAANAGLLNALKLIQPLKDKYPNISYADLFQLASATAIEEAGGPDIPMKYGRVDVVAPEQCPEEGRLPDAGPPSPADHLRDVF-YRMGLDDKEIVALSGAHTLGRARPDRSGWGKPETKYTKTGPGEAGGQSWTVKWLKFDNSYFKDIKEKRDDDLLVLPTDAALFEDPSFKNYAEKYAEDVAAFFKDYAEAHAKLSNLG 340          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR_MAGGR (Cytochrome c peroxidase, mitochondrial OS=Magnaporthe grisea GN=CCP1 PE=3 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 2.226e-46
Identity = 113/269 (42.01%), Postives = 152/269 (56.51%), Query Frame = 3
Query:   84 KNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFG-TMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDK--AEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEK------DG-----------LLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG--FAE 824
            K+Y TV  D    +E+      G     +  P+++R+AWH++GTYD +T TGG  G TMR + E  H AN GL  A   LEP K ++P I+Y+DL+ L GV  ++   GP IP+ PGR DK  A    +GRLPDA Q  DH+R +F  +MG +D++IVAL+G H LGRCH +RSGF+GPWT +P +  N YF +LL  EK      DG           L+ LP+D  L++D  F+   +K                LKL ELG  FAE
Sbjct:   87 KDYQTVYNDIASRLEENPDYDDG-----SYGPVLVRLAWHASGTYDKETGTGGSNGATMRFSPEGGHGANAGLKAARDFLEPIKAKYPWITYSDLWILGGVCAIQEMLGPKIPYRPGRSDKDAAACTPDGRLPDAAQRQDHVRNIF-YRMGFNDQEIVALAGAHALGRCHTDRSGFDGPWTFSPTVLTNDYF-KLLLNEKWEYKKWDGPKQYVDSKTKSLMMLPADMCLIEDKKFKEWTKKYADDNDLFFKDFSAAVLKLFELGVPFAE 348          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR2_USTMA (Putative heme-binding peroxidase OS=Ustilago maydis GN=CCP2 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 3.796e-46
Identity = 106/242 (43.80%), Postives = 133/242 (54.96%), Query Frame = 3
Query:  168 NCAPLMLRIAWHSAGTYDVKTKTGGPFGT-MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEP---PQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELL----------------------TGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            +  P+++R+AWH++GTY  +T TGG  G  MR  AE    AN GL  A   LEP KE+   I+YADL+ LAGVV +E  GGP I + PGR D A+    P  GRLPD  QG DHLR +F  +MG +D++IVALSG H LGRCH +RSGFEGPW  +P  F N Y+  LL                        + + L+ LP+D AL+ D   RP VEK                 KL ELG
Sbjct:   27 SAGPVLVRLAWHASGTYCARTDTGGSNGAGMRYEAEGGDPANAGLQHARVFLEPIKEKHSWITYADLWTLAGVVAIEAMGGPSIQWKPGRTDFADDSRLPPRGRLPDGAQGADHLRFIFN-RMGFNDQEIVALSGAHNLGRCHSDRSGFEGPWVNSPTRFSNQYYKLLLKLKWQPKKWDGPFQYVAKAPGADDDDEQLMMLPTDYALIQDEKMRPWVEKYAEDRDAFFNDFAKVFAKLIELG 267          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR2_MAGGR (Putative heme-binding peroxidase OS=Magnaporthe grisea GN=MGG_10368 PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 4.198e-45
Identity = 110/241 (45.64%), Postives = 131/241 (54.36%), Query Frame = 3
Query:  168 NCAPLMLRIAWHSAGTYDVKTKTGGPFGT-MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEP---PQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELL-----------TGEK----------DGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            +  P+++R+AWHSAGTYD  T TGG  G  MR  AE    AN GL  A + LEP K + P I+YADL  LAGVV V   GGP+IP+  GR D A+    P  GRLPDA QG  H+R +F  +MG  D++IVALSG H+LGRCH   SGFEG W  NP  F N YF  LL           TG K          D L+ LP+D +L  DPVF   V+                  KL ELG
Sbjct:   28 SAGPVLVRLAWHSAGTYDKSTDTGGSNGAGMRYEAEGGDPANAGLQNARQFLEPVKARHPWITYADLRTLAGVVAVRAMGGPEIPWRAGRTDFADDSRVPPRGRLPDATQGAAHVRDIF-YRMGFDDREIVALSGAHSLGRCHPANSGFEGKWVNNPTRFSNQYFRLLLSEDWREKTVAGTGLKQFVAVDEVTGDELMMLPTDLSLTSDPVFARWVKVYRDDQDLFFADFAKVFDKLMELG 267          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX7_ORYSJ (Probable L-ascorbate peroxidase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=APX7 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 4.198e-45
Identity = 106/256 (41.41%), Postives = 137/256 (53.52%), Query Frame = 3
Query:  123 VEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKT----GGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEP---PQEGRLPDA--KQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGP----------------WTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            ++  +  +R  +   +C P+++R+ WH +GTYD   K     GG  G++R   E  H AN GL  A++L++P K+++P ISYADL+QLA    +E  GGP IP   GR D   P   P EG+LPDA      DHLR+VF  +MGL DK+IV LSG HTLGR   ERSG+  P                WT   L FDNSYF E+       LL LP+D AL +DP F+   EK               H KLS LG
Sbjct:   92 LKAAREDIRELLKTTHCHPILVRLGWHDSGTYDKNIKEWPQRGGANGSLRFDVELKHGANAGLVNALKLVQPIKDKYPNISYADLFQLASATAIEEAGGPKIPMTYGRIDVTGPEQCPPEGKLPDAGPSAPADHLRKVF-YRMGLDDKEIVVLSGAHTLGRSRPERSGWGKPETKYTKNGPGAPGGQSWTAEWLKFDNSYFKEIKEKRDQDLLVLPTDAALFEDPTFKVYAEKYAEDQEAFFKDYAGAHAKLSNLG 346          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR_USTMA (Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis GN=CCP1 PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 7.160e-45
Identity = 102/235 (43.40%), Postives = 134/235 (57.02%), Query Frame = 3
Query:  177 PLMLRIAWHSAGTYDVKTKTGGPFG-TMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDD----KAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEK-----------------DGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            P+++R+AWH++GTYD  + TGG  G TMR A E  H AN GL  A   +E   ++FP I+Y+DL+ L GV  ++  GGP IP+ PGR D    K  P  +GRLPD  +G DHLR +F  +MG +D++IVALSG H LGRCH +RSGF+GPWT  P  F N YF  LL  EK                   L+ L +D AL+ DP F+  V++               + KL ELG
Sbjct:  137 PVLVRLAWHASGTYDKNSNTGGSNGATMRFAPESEHGANAGLGAARDFMEKIHQKFPWITYSDLWTLGGVAAIQELGGPKIPWRPGRKDATADKCTP--DGRLPDGDKGPDHLRYIF-YKMGFNDQEIVALSGAHALGRCHTDRSGFDGPWTFAPTSFTNEYF-NLLMNEKWNIRKWNGPPQFEDKSTKSLMMLMTDMALVQDPSFKKHVQRYAKSEDEFFNDFRSAYAKLLELG 367          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX8_ORYSJ (Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 1.221e-44
Identity = 106/256 (41.41%), Postives = 143/256 (55.86%), Query Frame = 3
Query:  123 VEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKT----GGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDD---KAEPPQEGRLPDA--KQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGF---------EGP-------WTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            ++  +  +R  +    C P+M+R+ WH +GTYD   +     GG  G++R  AE +H AN GL  A++L++P K+++P I+YADL+QLA    +E  GGP IP   GR D     + P EGRLPDA  +   DHLR+VF  +MGL DK+IVALSG HTLGR   +RSG+         +GP       WT   L FDNSYF ++       LL LP+D AL +DP F+   EK               H KLS+LG
Sbjct:   91 LKSAREDIREILKTTYCHPIMVRLGWHDSGTYDKNIEEWPQRGGADGSLRFDAELSHGANAGLINALKLIQPIKDKYPGITYADLFQLASATAIEEAGGPKIPMKYGRVDVTAAEQCPPEGRLPDAGPRVPADHLREVF-YRMGLDDKEIVALSGAHTLGRSRPDRSGWGKPETKYTKDGPGEPGGQSWTVEWLKFDNSYFKDIKEQRDQDLLVLPTDAALFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSDLG 345          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR2_CRYNE (Putative heme-binding peroxidase OS=Cryptococcus neoformans GN=CNE03890 PE=3 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.595e-44
Identity = 106/247 (42.91%), Postives = 140/247 (56.68%), Query Frame = 3
Query:  108 DYKKAVEKCKRKLR--GFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGT-MRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDD----KAEPPQEG----RLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            DY+   E+ K+ ++  G+  + +  P+++R+AWH++G + +    GG  G  MR   E    AN GL  A+  L P +     IS+ADL+ LAGV  +E  GGP IP+ PGR D    +A     G    RLPD   G  H+R VFG +MG SD++IVALSG H LGRCH +RSGF+GPW  NP  F N YF  LL G +  L+ LP+D AL++DP FRP VEK                 KL ELG
Sbjct:    8 DYQALKEEIKKIMKQPGY-DDGSAGPVLVRLAWHASGNFSLVEHNGGSNGAGMRFPPESVDPANAGLHYAISFLLPLQSANSWISHADLWTLAGVTAIEAMGGPQIPWEPGRLDYESEQAAVEHRGDVSNRLPDGALGAAHIRDVFG-RMGFSDQEIVALSGAHNLGRCHADRSGFDGPWVVNPTRFSNQYFKLLLPGTR--LMMLPTDMALIEDPSFRPWVEKYAADQNLFFKDFANAFGKLIELG 250          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APXS_ARATH (L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2)

HSP 1 Score: 177.563 bits (449), Expect = 7.916e-44
Identity = 115/275 (41.82%), Postives = 146/275 (53.09%), Query Frame = 3
Query:   66 SVEKMTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKT----GGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEP---PQEGRLPDAKQGN--DHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGF---------EGP-------WTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELG 815
            S    TK+  +  +  K A E  K  L    + K C P+++R+ WH AGTY+   K     GG  G++R   E  H+AN GL  A+ L++  KE++  ISYADL+QLA    +E  GGP IP   GR D + P   P+EGRLPDA   +   HLR+VF  +MGL DKDIVALSG HTLGR   ERSG+         EGP       WT   L FDNSYF E+     + LL LP+D A+ +D  F+   EK               H KLS LG
Sbjct:   92 STTAATKSSSSDPDQLKNAREDIKELL----STKFCHPILVRLGWHDAGTYNKNIKEWPQRGGANGSLRFDIELKHAANAGLVNALNLIKDIKEKYSGISYADLFQLASATAIEEAGGPKIPMKYGRVDASGPEDCPEEGRLPDAGPPSPATHLREVF-YRMGLDDKDIVALSGAHTLGRSRPERSGWGKPETKYTKEGPGAPGGQSWTPEWLKFDNSYFKEIKEKRDEDLLVLPTDAAIFEDSSFKVYAEKYAADQDAFFKDYAVAHAKLSNLG 361          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: CCPR_YARLI (Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica GN=CCP1 PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.493e-42
Identity = 104/254 (40.94%), Postives = 141/254 (55.51%), Query Frame = 3
Query:   36 GFASLFLISFSVEKMTKNYPTVSEDYKKAVEKCKRKL--RGFIAEKNCAPLMLRIAWHSAGTYDVK-TKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAE--PPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEK------DG-----------LLQLPSDKALLDDPVFR 731
            G  + +  + S     + +     DY+K  +    KL       + +  P++LR+AWHS+GTY+    K G   GTMR   E +H+ANNGL  A   L+P  E+FP IS  DLY L GV  V+  GGP IP+  GR D+ E   P +G LPDA QG  H+R VF  Q G +D+++VAL G H LGRCHK+ SGFEGPWT +P +F N ++ +LL  +K      DG           L+ LP+D AL  D  F+
Sbjct:   44 GAGAYYYYANSPAAKVETFNATKADYQKVYDAIADKLIEDDDYDDGSYGPVLLRLAWHSSGTYNKSDNKFGSSGGTMRFKPEASHAANNGLVNARNFLKPIHEKFPWISTGDLYTLGGVTAVQELGGPIIPWKRGRVDEPESASPPDGSLPDASQGATHVRNVFNRQ-GFNDQEMVALIGAHALGRCHKQNSGFEGPWTFSPTMFTNDFY-KLLLDDKWQWKKWDGNPQYEDVKTKSLMMLPTDMALATDKNFK 295          
The following BLAST results are available for this feature:
BLAST of FC929463 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
APXT_ARATH5.857e-4743.25L-ascorbate peroxidase T, chloroplastic OS=Arabido... [more]
CCPR_MAGGR2.226e-4642.01Cytochrome c peroxidase, mitochondrial OS=Magnapor... [more]
CCPR2_USTMA3.796e-4643.80Putative heme-binding peroxidase OS=Ustilago maydi... [more]
CCPR2_MAGGR4.198e-4545.64Putative heme-binding peroxidase OS=Magnaporthe gr... [more]
APX7_ORYSJ4.198e-4541.41Probable L-ascorbate peroxidase 7, chloroplastic O... [more]
CCPR_USTMA7.160e-4543.40Cytochrome c peroxidase, mitochondrial OS=Ustilago... [more]
APX8_ORYSJ1.221e-4441.41Probable L-ascorbate peroxidase 8, chloroplastic O... [more]
CCPR2_CRYNE1.595e-4442.91Putative heme-binding peroxidase OS=Cryptococcus n... [more]
APXS_ARATH7.916e-4441.82L-ascorbate peroxidase S, chloroplastic/mitochondr... [more]
CCPR_YARLI1.493e-4240.94Cytochrome c peroxidase, mitochondrial OS=Yarrowia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2CD08RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2CD08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929463 ID=FC929463; Name=FC929463; organism=Citrus clementina; type=EST; length=850bp
CTCGTGCCTTATTCGGCACGAGGCTCGTTTGTTAAGGATTTGCGTCTCTC
TTTCTCATTTCATTCAGCGTTGAAAAGATGACGAAGAATTACCCCACTGT
TAGCGAGGATTACAAGAAGGCCGTGGAGAAATGCAAGAGGAAGCTCAGAG
GCTTCATCGCTGAGAAGAACTGCGCTCCACTCATGCTCCGTATCGCGTGG
CACTCAGCTGGTACATATGATGTGAAGACCAAGACCGGAGGTCCATTCGG
AACCATGAGGCTCGCTGCTGAGCAGGCACACTCAGCCAACAACGGCCTCG
ATATTGCCGTTAGGCTTTTGGAGCCGTTCAAGGAGCAGTTCCCTACCATC
TCCTACGCTGACCTTTATCAGCTTGCTGGTGTTGTTGGCGTTGAGGTTAC
CGGTGGGCCCGATATCCCCTTCCACCCGGGAAGAGATGACAAGGCTGAGC
CACCTCAAGAAGGCCGGCTTCCTGATGCTAAACAGGGTAATGATCACTTG
AGGCAAGTCTTTGGTGCTCAGATGGGCCTCAGCGACAAGGATATTGTTGC
TCTCTCTGGTGGCCACACCCTGGGAAGGTGCCACAAGGAGAGGTCTGGAT
TTGAGGGACCATGGACCCGCAACCCTCTCATTTTTGACAATTCCTACTTC
ACGGAGCTCTTGACTGGTGAGAAGGATGGTCTTCTGCAATTGCCATCCGA
CAAGGCCCTTCTGGATGACCCTGTTTTCCGCCCTCTTGTTGAGAAATATG
CTGCGGATGAGGACGCTTTCTTCGCTGATTATGCTGAGGCTCATCTCAAG
CTCTCTGAGCTAGGATTTGCTGAAGCCTAATTTAACTGAGTAAATAAATG
back to top