FC930278

Overview
NameFC930278
Unique NameFC930278
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length515
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:1..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930278 vs. ExPASy Swiss-Prot
Match: G3P_PHARH (Glyceraldehyde-3-phosphate dehydrogenase OS=Phaffia rhodozyma GN=GPD PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 8.878e-36
Identity = 75/142 (52.82%), Postives = 96/142 (67.61%), Query Frame = 3
Query:   87 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 512
            VK+GINGFGRIGR+V R  +   D+++VA+NDPFI  +YM YMFKYDS HG +K   +++KD K ++ G KP+ V+G R+P  I W   GA+YVVESTGVFT               V+ISAPS DAPMFV GVN  +Y P+
Sbjct:    3 VKVGINGFGRIGRIVLRNAIIHGDIDVVAINDPFIDLEYMVYMFKYDSTHGVFK-GSVEIKDGKLVIEG-KPIVVYGERDPANIQWGAAGADYVVESTGVFTTQEKAELHLKGGAKKVVISAPSADAPMFVCGVNLDKYDPK 142          
BLAST of FC930278 vs. ExPASy Swiss-Prot
Match: G3P2_TRIKO (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Trichoderma koningii GN=gpd2 PE=1 SV=3)

HSP 1 Score: 149.058 bits (375), Expect = 1.160e-35
Identity = 79/142 (55.63%), Postives = 96/142 (67.61%), Query Frame = 3
Query:   78 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 503
            M  +K+GINGFGRIGR+V R  ++  D+E+VAVNDPFI T Y  YM KYDS HG +K  E++V D K L+   K V  +  RNP +I W+ETGAEYVVESTGVFT               VIISAPS DAPM+V+GVNE +Y
Sbjct:    1 MAPIKVGINGFGRIGRIVFRNAVEHPDIEVVAVNDPFIETTYAAYMLKYDSSHGLFKG-EVEV-DGKDLVVNGKKVRFYTERNPADIKWSETGAEYVVESTGVFTTTEKAKAHLVGGAKKVIISAPSADAPMYVMGVNESDY 140          
BLAST of FC930278 vs. ExPASy Swiss-Prot
Match: G3P_FELCA (Glyceraldehyde-3-phosphate dehydrogenase OS=Felis catus GN=GAPDH PE=2 SV=3)

HSP 1 Score: 148.673 bits (374), Expect = 1.514e-35
Identity = 75/143 (52.45%), Postives = 95/143 (66.43%), Query Frame = 3
Query:   87 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 515
            VK+G+NGFGRIGRLV R       V++VA+NDPFI  +YM YMF+YDS HG++ H  +K ++ K ++ G KP+T+F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKF-HGTVKAENGKLVING-KPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC930278 vs. ExPASy Swiss-Prot
Match: G3P_RAT (Glyceraldehyde-3-phosphate dehydrogenase OS=Rattus norvegicus GN=Gapdh PE=1 SV=3)

HSP 1 Score: 147.902 bits (372), Expect = 2.583e-35
Identity = 75/143 (52.45%), Postives = 96/143 (67.13%), Query Frame = 3
Query:   87 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 515
            VK+G+NGFGRIGRLV R     D V++VA+NDPFI  +YM YMF+YDS HG++ +  +K ++ K ++ G KP+T+F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFSCDKVDIVAINDPFIDLNYMVYMFQYDSTHGKF-NGTVKAENGKLVING-KPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC930278 vs. ExPASy Swiss-Prot
Match: G3P_PICPA (Glyceraldehyde-3-phosphate dehydrogenase OS=Pichia pastoris GN=GPD PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.583e-35
Identity = 75/143 (52.45%), Postives = 95/143 (66.43%), Query Frame = 3
Query:   87 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 515
            + +GINGFGRIGRLV RV L R D+++VA+NDPFI  +Y  YMFKYDS H  +K  E+    +K  + G K +TVF  R+P  IPW + G +YV+ESTGVFT               V+I+APSKDAPMFVVGVNE +Y  +L
Sbjct:    3 ITVGINGFGRIGRLVLRVALSRADIKVVAINDPFIAPEYAAYMFKYDSTHKAYKG-EVSASGNKINIDG-KEITVFQERDPVNIPWGKAGVDYVIESTGVFTTLEGAQKHIDAGAKKVVITAPSKDAPMFVVGVNEEKYTSDL 143          
BLAST of FC930278 vs. ExPASy Swiss-Prot
Match: G3P_PHACH (Glyceraldehyde-3-phosphate dehydrogenase OS=Phanerochaete chrysosporium GN=GPD PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.583e-35
Identity = 78/139 (56.12%), Postives = 92/139 (66.19%), Query Frame = 3
Query:   87 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 503
            VK GINGFGRIGR+V R  L   D+++VAVNDPFI  +YM YMFKYDSVHG++K   ++ KD K  + G KP+ VF  ++P  IPW   GAEY+VESTGVFT               VIISAPS DAPMFV GVN   Y
Sbjct:    3 VKAGINGFGRIGRIVLRNALLHGDIDVVAVNDPFIDLEYMVYMFKYDSVHGRFK-GSVEAKDGKLYVEG-KPIHVFAEKDPANIPWGSVGAEYIVESTGVFTTTEKASAHLKGVCKKVIISAPSADAPMFVCGVNLDAY 139          
BLAST of FC930278 vs. ExPASy Swiss-Prot
Match: G3P_MOUSE (Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus GN=Gapdh PE=1 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 2.583e-35
Identity = 76/143 (53.15%), Postives = 96/143 (67.13%), Query Frame = 3
Query:   87 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 515
            VK+G+NGFGRIGRLV R  +    VE+VA+NDPFI  +YM YMF+YDS HG++ +  +K ++ K ++ G KP+T+F  R+P  I W E GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKF-NGTVKAENGKLVING-KPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC930278 vs. ExPASy Swiss-Prot
Match: G3P_TRISI (Glyceraldehyde-3-phosphate dehydrogenase OS=Trionyx sinensis GN=GAPDH PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.374e-35
Identity = 75/143 (52.45%), Postives = 95/143 (66.43%), Query Frame = 3
Query:   87 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 515
            VKIG+NGFGRIGRLV R     D V++VA+NDPFI  +YM YMFKYDS HG++ H  +K ++ K ++ G+  +T+F  R+P  I W + GAEYVVESTGVFT               V+ISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKIGVNGFGRIGRLVTRAAFTCDKVQIVAINDPFIDLNYMVYMFKYDSTHGRF-HGTVKAENGKLVINGQ-AITIFQERDPANIKWGDAGAEYVVESTGVFTTTEKASAHLKGGAKRVVISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC930278 vs. ExPASy Swiss-Prot
Match: G3P_COCHE (Glyceraldehyde-3-phosphate dehydrogenase OS=Cochliobolus heterostrophus GN=GPD1 PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 5.755e-35
Identity = 76/143 (53.15%), Postives = 94/143 (65.73%), Query Frame = 3
Query:   87 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 515
            VK+GINGFGRIGR+V R  ++ +DV++VAVNDPFI   Y  YM KYDS HGQ+K  ++KV D   L    K +     ++P  IPW+ETGA YVVESTGVFT               V+ISAPS DAPMFV+GVN   YKP++
Sbjct:    3 VKVGINGFGRIGRIVFRNAIEHNDVDIVAVNDPFIEPHYAAYMLKYDSTHGQFK-GDIKV-DGNNLTVNGKTIRFHMEKDPANIPWSETGAYYVVESTGVFTTTEKAKAHLKGGAKKVVISAPSPDAPMFVMGVNHETYKPDI 143          
BLAST of FC930278 vs. ExPASy Swiss-Prot
Match: G3P_PANVR (Glyceraldehyde-3-phosphate dehydrogenase OS=Panulirus versicolor PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 7.516e-35
Identity = 78/142 (54.93%), Postives = 95/142 (66.90%), Query Frame = 3
Query:   90 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 515
            KIGINGFGRIGRLV R  L+    ++VAVNDPFI  +YM YMFKYDS HG +K  E+K +D   ++ G+K +TVF    PE IPW++ GAEY+VESTGVFT               VIISAPS DAPMFV GVN  +Y  ++
Sbjct:    2 KIGINGFGRIGRLVLRAALEMG-AQVVAVNDPFIALEYMVYMFKYDSTHGMFKG-EVKAEDGALVVDGKK-ITVFNEMKPENIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVIISAPSADAPMFVCGVNLEKYSKDM 140          
The following BLAST results are available for this feature:
BLAST of FC930278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 308
Match NameE-valueIdentityDescription
G3P_PHARH8.878e-3652.82Glyceraldehyde-3-phosphate dehydrogenase OS=Phaffi... [more]
G3P2_TRIKO1.160e-3555.63Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Tric... [more]
G3P_FELCA1.514e-3552.45Glyceraldehyde-3-phosphate dehydrogenase OS=Felis ... [more]
G3P_RAT2.583e-3552.45Glyceraldehyde-3-phosphate dehydrogenase OS=Rattus... [more]
G3P_PICPA2.583e-3552.45Glyceraldehyde-3-phosphate dehydrogenase OS=Pichia... [more]
G3P_PHACH2.583e-3556.12Glyceraldehyde-3-phosphate dehydrogenase OS=Phaner... [more]
G3P_MOUSE2.583e-3553.15Glyceraldehyde-3-phosphate dehydrogenase OS=Mus mu... [more]
G3P_TRISI3.374e-3552.45Glyceraldehyde-3-phosphate dehydrogenase OS=Triony... [more]
G3P_COCHE5.755e-3553.15Glyceraldehyde-3-phosphate dehydrogenase OS=Cochli... [more]
G3P_PANVR7.516e-3554.93Glyceraldehyde-3-phosphate dehydrogenase OS=Panuli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34005G02EF PostHarvC1 Citrus clementina cDNA clone C34005G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930278 ID=FC930278; Name=FC930278; organism=Citrus clementina; type=EST; length=515bp
GAGACACGACTGCACTCTCTACTCTCTACAACTTTCTTCACCACTCTTTC
ACCGCTCAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAAT
CAACGGATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGA
GGGACGATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGAT
TACATGACATACATGTTTAAGTACGACAGTGTTCACGGTCAATGGAAGCA
CCATGAATTGAAGGTTAAGGACGACAAGACCCTTCTCTTTGGTGAGAAGC
CTGTCACTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAG
ACTGGAGCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACTGACAAGGA
TAAGGCTGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAG
CCCCCAGCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAG
TACAAACCAGAGCTC
back to top