FC930427
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC930427 vs. ExPASy Swiss-Prot
Match: FAD12_CREAL (Delta(12) fatty acid dehydrogenase OS=Crepis alpina PE=2 SV=2) HSP 1 Score: 68.5514 bits (166), Expect = 3.791e-11 Identity = 29/73 (39.73%), Postives = 43/73 (58.90%), Query Frame = 1 Query: 472 PLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLEDIVGTLAFLPLIYPYEPWRFKHGKHHAKTNMLNGDTAWHP 690 PL W + +TG +VIGH+C H +FS + ++D VG + L+ PY W++ H HHA TN L+ D + P Sbjct: 80 PLYWFCQASILTGLWVIGHECGHHAFSDYQWVDDTVGFILHSFLMTPYFSWKYSHRNHHANTNSLDNDEVYIP 152
BLAST of FC930427 vs. ExPASy Swiss-Prot
Match: FAD6E_BRAJU (Omega-6 fatty acid desaturase, endoplasmic reticulum OS=Brassica juncea PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 4.952e-11 Identity = 29/73 (39.73%), Postives = 42/73 (57.53%), Query Frame = 1 Query: 472 PLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLEDIVGTLAFLPLIYPYEPWRFKHGKHHAKTNMLNGDTAWHP 690 PL WA G +TG +VI H+C H +FS + L+D VG + L+ PY W++ H +HH+ T L D + P Sbjct: 87 PLYWACQGVVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSNTGSLERDEVFVP 159
BLAST of FC930427 vs. ExPASy Swiss-Prot
Match: FD6E1_SOYBN (Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 1 OS=Glycine max GN=FAD2-1 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.446e-11 Identity = 27/73 (36.99%), Postives = 42/73 (57.53%), Query Frame = 1 Query: 472 PLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLEDIVGTLAFLPLIYPYEPWRFKHGKHHAKTNMLNGDTAWHP 690 P+ W G +TG +VI H+C H +FSK + ++D+VG L+ PY W+ H +HH+ T L+ D + P Sbjct: 91 PIYWVLQGCLLTGVWVIAHECGHHAFSKYQWVDDVVGLTLHSTLLVPYFSWKISHRRHHSNTGSLDRDEVFVP 163 The following BLAST results are available for this feature:
BLAST of FC930427 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 23
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC930427 ID=FC930427; Name=FC930427; organism=Citrus clementina; type=EST; length=699bpback to top |