FC930464
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of FC930464 vs. ExPASy Swiss-Prot
Match: IKU2_ARATH (Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.204e-11 Identity = 39/84 (46.43%), Postives = 53/84 (63.10%), Query Frame = 3 Query: 3 SKDIVNWVYS--KMDSRDSMLTVVDPNISEILKEDALKVLRIAIHCTNKLPAFRPSMRVVVQMLEEAEPCSVTNIVVKKVGESS 248 + DIV WV+S K +R+ M+ ++D +I + KEDALKVL IA+ CT+K P RP M+ VV MLE+ EP N GES+ Sbjct: 900 NNDIVMWVWSVSKETNREMMMKLIDTSIEDEYKEDALKVLTIALLCTDKSPQARPFMKSVVSMLEKIEPSYNKNSGEASYGESA 983
BLAST of FC930464 vs. ExPASy Swiss-Prot
Match: PIP_MYCGE (Putative proline iminopeptidase OS=Mycoplasma genitalium GN=pip PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.446e-11 Identity = 31/61 (50.82%), Postives = 39/61 (63.93%), Query Frame = 1 Query: 466 GILKVSDIHTIYWE*SGNPTGHPVVFLHGGPGGGTTPSNRRFFDPDFYRIILFDQRGAGKS 648 G L V D H +Y+ GNP G PV+++HGGPG GT ++FD + IIL DQRG GKS Sbjct: 9 GYLNVGDNHQLYYWTQGNPNGKPVLYIHGGPGSGTDEGCLKYFDLETTWIILLDQRGCGKS 69 The following BLAST results are available for this feature:
BLAST of FC930464 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC930464 ID=FC930464; Name=FC930464; organism=Citrus clementina; type=EST; length=700bpback to top |