FC930520

Overview
NameFC930520
Unique NameFC930520
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length751
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC930520_ssr589 microsatellite FC930520_ssr589:589..600. BLAST: Citrus ESTs to Prunus persica proteins V1
FC930520_ssr612 microsatellite FC930520_ssr612:612..623. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15166 contig Ccv1_Contig15166:1..748. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKB1A_RABIT (Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Oryctolagus cuniculus GN=FKBP1A PE=3 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 1.518e-16
Identity = 42/82 (51.22%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  257 VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            VHY G L E G+ FD++ + N  F F LGK  VIR W+  +  M VG+ AKLT  P+YAYG+ G P  +PP ATL+F+VEL+
Sbjct:   25 VHYTGML-EDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL 105          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKB1A_HUMAN (Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens GN=FKBP1A PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 1.518e-16
Identity = 42/82 (51.22%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  257 VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            VHY G L E G+ FD++ + N  F F LGK  VIR W+  +  M VG+ AKLT  P+YAYG+ G P  +PP ATL+F+VEL+
Sbjct:   25 VHYTGML-EDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL 105          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKBP1_DICDI (FK506-binding protein 1 OS=Dictyostelium discoideum GN=fkbp1 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.983e-16
Identity = 40/84 (47.62%), Postives = 58/84 (69.05%), Query Frame = 2
Query:  251 VDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            V VH+ G+L   G VFD++ +    F+F+LG G VI+ WD  +  MKVGE +KLT  P++ YG+ G+   +PP+ATL+FEVEL+
Sbjct:   22 VTVHHAGTLTN-GTVFDSSRKRGQPFNFKLGAGQVIKGWDEGVAKMKVGETSKLTISPDFGYGARGAGGVIPPNATLVFEVELI 104          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKBP6_MOUSE (FK506-binding protein 6 OS=Mus musculus GN=Fkbp6 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.418e-16
Identity = 43/114 (37.72%), Postives = 68/114 (59.65%), Query Frame = 2
Query:  161 IDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            +D++GD GV+K I+R+   D ++P      V V Y G L    + FD+     T    +LG+   +   ++ L SM+ GE+A+   KP YAYG+ G PP +PP+AT++FE+EL+
Sbjct:   30 LDISGDRGVLKDIIREGTGDTVTPDAS---VLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRKGELARFLFKPAYAYGTLGCPPLIPPNATVLFEIELI 140          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKBP2_CRYNE (FK506-binding protein 2 OS=Cryptococcus neoformans GN=FPR2 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.418e-16
Identity = 40/89 (44.94%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  251 VDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPR 517
            + +HY G+LA+ G  FD++ + N  F F LG G VI+ WD  L  M + E  KLT     AYG  G PP +PP +TL+FEVEL+  + R
Sbjct:   48 LSMHYTGTLAKDGSKFDSSLDRNRPFEFTLGAGQVIKGWDQGLLDMCISEKRKLTIPSHLAYGERGHPPVIPPQSTLVFEVELLGIKNR 136          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKBP_CRYNV (FK506-binding protein 1 OS=Cryptococcus neoformans var. grubii GN=FRR1 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.770e-16
Identity = 39/84 (46.43%), Postives = 56/84 (66.67%), Query Frame = 2
Query:  251 VDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            V +HY G+L + G  FD++ +  T F   +G+G VIR WD  +  + VG+ A L C P+YAYG+ G PP +PP++TL FEVEL+
Sbjct:   23 VTIHYVGTLLD-GSKFDSSRDRGTPFVCRIGQGQVIRGWDEGVPQLSVGQKANLICTPDYAYGARGFPPVIPPNSTLKFEVELL 105          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKB1A_RAT (Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Rattus norvegicus GN=Fkbp1a PE=2 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 5.770e-16
Identity = 41/82 (50.00%), Postives = 54/82 (65.85%), Query Frame = 2
Query:  257 VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            VHY G L E G+ FD++ + N  F F LGK  VIR W+  +  M VG+ AKL   P+YAYG+ G P  +PP ATL+F+VEL+
Sbjct:   25 VHYTGML-EDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISPDYAYGATGHPGIIPPHATLVFDVELL 105          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKBP_CRYNE (FK506-binding protein 1 OS=Cryptococcus neoformans GN=FPR1 PE=3 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 7.536e-16
Identity = 38/84 (45.24%), Postives = 56/84 (66.67%), Query Frame = 2
Query:  251 VDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            V +HY G+L + G  FD++ +  T F   +G+G VIR WD  +  + +G+ A L C P+YAYG+ G PP +PP++TL FEVEL+
Sbjct:   23 VTIHYVGTLLD-GSKFDSSRDRGTPFVCRIGQGQVIRGWDEGVPQLSIGQKANLICTPDYAYGARGFPPVIPPNSTLKFEVELL 105          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKBP2_YEAST (FK506-binding protein 2 OS=Saccharomyces cerevisiae GN=FKB2 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 7.536e-16
Identity = 47/107 (43.93%), Postives = 61/107 (57.01%), Query Frame = 2
Query:  182 GVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            G+IK+I  +   D L        V VHY GSL E+G VFD+++   +  +FELG G VI+ WD  +  M VGE  KL      AYG  G P  +PP A L+F+VELV
Sbjct:   26 GIIKRIPVE---DCLIKAMPGDKVKVHYTGSLLESGTVFDSSYSRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAYGERGVPGVIPPSADLVFDVELV 129          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKBP6_HUMAN (FK506-binding protein 6 OS=Homo sapiens GN=FKBP6 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.285e-15
Identity = 41/114 (35.96%), Postives = 67/114 (58.77%), Query Frame = 2
Query:  161 IDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            +D++GD GV+K ++R+   D ++P      V V Y G L      FD+ +   T    +LG+   +   ++ L SM+ GE+A+   KP YAYG+ G PP +PP+ T++FE+EL+
Sbjct:   30 LDISGDRGVLKDVIREGAGDLVAPDAS---VLVKYSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELL 140          
The following BLAST results are available for this feature:
BLAST of FC930520 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
FKB1A_RABIT1.518e-1651.22Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Oryc... [more]
FKB1A_HUMAN1.518e-1651.22Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo... [more]
FKBP1_DICDI1.983e-1647.62FK506-binding protein 1 OS=Dictyostelium discoideu... [more]
FKBP6_MOUSE4.418e-1637.72FK506-binding protein 6 OS=Mus musculus GN=Fkbp6 P... [more]
FKBP2_CRYNE4.418e-1644.94FK506-binding protein 2 OS=Cryptococcus neoformans... [more]
FKBP_CRYNV5.770e-1646.43FK506-binding protein 1 OS=Cryptococcus neoformans... [more]
FKB1A_RAT5.770e-1650.00Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Ratt... [more]
FKBP_CRYNE7.536e-1645.24FK506-binding protein 1 OS=Cryptococcus neoformans... [more]
FKBP2_YEAST7.536e-1643.93FK506-binding protein 2 OS=Saccharomyces cerevisia... [more]
FKBP6_HUMAN1.285e-1535.96FK506-binding protein 6 OS=Homo sapiens GN=FKBP6 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34008D10EF PostHarvC1 Citrus clementina cDNA clone C34008D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930520 ID=FC930520; Name=FC930520; organism=Citrus clementina; type=EST; length=751bp
GACTCACTAGACGCCTATGGCCACCAAAATCCACGGCAATTTCTCCCGAT
TTATTGTCCCCGAGTCAATCGGTCAACTCGATCTCTCTTTTACGGTCGAT
AATTTTCATCTCATCACGATACGGTAGGGTTTTAAGCATTGAGAAGTTAT
GGGTGATTCAATTGATTTGACGGGTGATGAAGGTGTCATCAAGAAGATCG
TAAGGCAAGCTAAACCTGATGCTCTCTCTCCTACTGAGGACCTTCCTCTT
GTTGATGTTCATTATGAAGGCAGTCTTGCTGAAACTGGTGAAGTTTTCGA
TACCACACATGAAGACAATACTGTATTTTCTTTTGAGCTTGGGAAGGGTT
CAGTGATTCGGGCTTGGGATATTGCATTAAGAAGCATGAAGGTTGGGGAG
GTTGCAAAACTCACTTGCAAGCCAGAATATGCCTATGGCAGTGCAGGATC
TCCTCCAGATGTCCCACCTGATGCGACACTTATTTTTGAGGTGGAGTTGG
TGGCCTGCAGGCCAAGGAAAGGTTCTAGTCTTGGTAGCGTATCGGAAGAG
AGAGCCAGGCTAGAGGAGCTTAAGAGGCAAAGAGAGCTTGCTGCTGCTGC
GAAAGAGGAGGAGAAGAAGAAGAGAGAAGAAGCCNAAGCTGCAGCAGCTG
CTCGTATTCAAGCCAAATGGAAGCCAAGAAGGTCAGGAAAGGGGAAAGCA
AGGGGAAATAGGGTATGTATCCCGCTCATATGGATAGCGATATGTGTGAT
G
back to top