FC930813
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC930813 vs. ExPASy Swiss-Prot
Match: YCF3_CHLAT (Photosystem I assembly protein ycf3 OS=Chlorokybus atmophyticus GN=ycf3 PE=3 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 7.602e-11 Identity = 31/42 (73.81%), Postives = 37/42 (88.10%), Query Frame = 2 Query: 98 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 223 MPRS+ N NFIDKTF++VA+ILL+I+PTT EKEAF YYRDG Sbjct: 1 MPRSQRNDNFIDKTFTVVADILLKILPTTGREKEAFAYYRDG 42
BLAST of FC930813 vs. ExPASy Swiss-Prot
Match: YCF3_MESVI (Photosystem I assembly protein ycf3 OS=Mesostigma viride GN=ycf3 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 9.928e-11 Identity = 29/42 (69.05%), Postives = 38/42 (90.48%), Query Frame = 2 Query: 98 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 223 MPRS+ N NFIDKTF++VA+I+L+++PTTV EK AF+YYRDG Sbjct: 1 MPRSQKNDNFIDKTFTVVADIILKVLPTTVREKAAFSYYRDG 42 The following BLAST results are available for this feature:
BLAST of FC930813 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 82
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC930813 ID=FC930813; Name=FC930813; organism=Citrus clementina; type=EST; length=666bpback to top |