FC931064

Overview
NameFC931064
Unique NameFC931064
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length708
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15262 contig Ccv1_Contig15262:1..708. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y995_THETN (UPF0189 protein TTE0995 OS=Thermoanaerobacter tengcongensis GN=TTE0995 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 9.780e-23
Identity = 61/126 (48.41%), Postives = 77/126 (61.11%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIY-GVTINPEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEF 695
            VN+AN  ++GGGG DGAIH+A GP + E    + E   G  CPTG A IT    L A +VIH VGPI+ G   N +  L SAY  SL LA   N++ IAFP+IS G Y +P E AA IA+  V ++
Sbjct:   21 VNAANSSLIGGGGVDGAIHKAGGPAIAEELKVIREKQGG--CPTGHAVITGAGNLKAKYVIHAVGPIWKGGNHNEDNLLASAYIESLKLADEYNVKTIAFPSISTGAYGFPVERAARIALRVVSDY 144          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y6450_STRCO (UPF0189 protein SCO6450 OS=Streptomyces coelicolor GN=SCO6450 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 9.780e-23
Identity = 57/122 (46.72%), Postives = 72/122 (59.02%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGVTINPEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTV 686
            VN+AN  +LGGGG DGAIHR  GP +L  C R+     G   PTG A  T    L A  VIHTVGP++  T +    L S Y+ SL  A     + +AFPAIS G+Y +P ++AA IA+ TV
Sbjct:   20 VNAANSSLLGGGGVDGAIHRRGGPAILAECRRLRAGHLGKGLPTGRAVATTAGDLDARWVIHTVGPVWSATEDRSGLLASCYRESLRTADELGARTVAFPAISTGVYRWPMDDAARIAVETV 141          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y2902_LISIN (UPF0189 protein lin2902 OS=Listeria innocua GN=lin2902 PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.845e-22
Identity = 61/130 (46.92%), Postives = 83/130 (63.85%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRV-PEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGVTINPEAS-LRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEFAND 704
            VN+AN  +LGGGG DGAIH+AAGP+LL+ C  V   +G    CP GEA IT    L A  +IH VGPI+    + EA+ L S Y  +L LA   ++  IAFP IS G+Y +P + AA +A+ TV+++A +
Sbjct:   19 VNAANPGLLGGGGVDGAIHQAAGPDLLKECQEVINRIG---SCPAGEAVITSAGDLKAHFIIHAVGPIWKDGEHQEANKLASCYWKALDLAAGKDLTSIAFPNISTGVYGFPKKLAAEVALYTVRKWAEE 145          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y1951_FUSNN (UPF0189 protein FN1951 OS=Fusobacterium nucleatum subsp. nucleatum GN=FN1951 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.716e-22
Identity = 62/126 (49.21%), Postives = 78/126 (61.90%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGVTINPEAS-LRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEF 695
            VN+AN  +  GGG  GAI +AAG EL + C    E+G    C TGEA IT G+ LP  ++IHTVGP Y    N EA  L SAY  SL LA    I+ IAFP+IS G+Y +P +E A IA++T  +F
Sbjct:   23 VNAANSSLEMGGGVCGAIFKAAGSELAQEC---KEIG---GCNTGEAVITKGYNLPNKYIIHTVGPRYSTGENREAERLASAYYESLKLANEKGIRRIAFPSISTGIYRFPVDEGAKIALTTAIKF 142          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y189_STRNO (UPF0189 protein in sno 5'region OS=Streptomyces nogalater PE=3 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.854e-22
Identity = 56/123 (45.53%), Postives = 73/123 (59.35%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGVTINPEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVK 689
            VN+AN  +LGGGG DGAIHR  GP +L  C  +    +G   PTG A  T    L A  VIHTVGP++  T +    L S Y+ SL LA     + +AFPA+S G+Y +P  +AA IA+ TV+
Sbjct:   20 VNAANSSLLGGGGVDGAIHRRGGPAILAECRALRASRYGEGLPTGRAVATTAGDLDARWVIHTVGPVWSSTEDRSDLLASCYRESLRLAGELGARTVAFPALSTGVYRWPMGDAARIAVETVR 142          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y2288_DEIRA (UPF0189 protein DR_2288 OS=Deinococcus radiodurans GN=DR_2288 PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.412e-21
Identity = 60/129 (46.51%), Postives = 83/129 (64.34%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLP---ASHVIHTVGPIYGVTINPEASLRS-AYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEF 695
            V +AN++++GGGG DG IHRAAGP LL+A   +  +G     PTG A ITP F L      +VIH VGPI+    + EA L + AY+ SL L   N  + +AFP+IS G+Y YP + AA IA++T+++F
Sbjct:   19 VTAANKQLMGGGGVDGVIHRAAGPRLLQA---IRPIG---GTPTGTAVITPAFDLERQGVKYVIHAVGPIWRGGQHGEAELLAGAYRESLRLGVENGCRSVAFPSISTGVYGYPLDRAAPIALATIQDF 141          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: Y189_ACISE (UPF0189 protein OS=Acinetobacter sp. (strain ED45-25) PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 7.749e-20
Identity = 55/124 (44.35%), Postives = 76/124 (61.29%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGP--IYGVTINPEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTV 686
            VNSAN+ +LGGGG D  IH+ AGP + E C R+ +   G  CPTG+A +T    LPA ++IH VGP  + G    P+  L  AY N+L  A   +   ++FP IS G+Y +P ++AA IAI T+
Sbjct:   20 VNSANKSLLGGGGLDYVIHKKAGPLMKEECVRLNQEKGG--CPTGQAEVTTAGNLPAKYLIHAVGPRWLDGEHNEPQL-LCDAYSNALFKANEIHALTVSFPCISTGVYGFPPQKAAEIAIGTI 140          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: GDAP2_NEMVE (Protein GDAP2 homolog OS=Nematostella vectensis GN=gdap2 PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.252e-18
Identity = 52/131 (39.69%), Postives = 74/131 (56.49%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGVTIN--PEASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEFANDF 707
            VN+ NE +   G     +HRAAGPEL++ C R   +G    C TGEA+I+ G+ LPA +VIHTVGP Y        E++L S Y+N++ L + N I  I    ++     YP E+ A IA+ TV+ F   +
Sbjct:   69 VNTTNESLSDRGALSERVHRAAGPELMQEC-RQQLLG----CRTGEAKISEGYNLPARYVIHTVGPRYNTKYKTAAESALFSCYRNTMRLVRENKISTIGVCVVNTTKRGYPPEDGAHIALRTVRRFLEKY 194          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: GDAP2_XENLA (Ganglioside-induced differentiation-associated protein 2 OS=Xenopus laevis PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.786e-16
Identity = 50/127 (39.37%), Postives = 70/127 (55.12%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGVTINP--EASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEF 695
            VN++NE +        +I R +GPELLE   ++        C TGEA++T GF L A ++IHTVGP Y        E+SL S Y+N L LAK   +  + F  I+    CYP ++A  IA+ TV+ F
Sbjct:   73 VNTSNETLTDKNPVSDSIFRYSGPELLEEMQKLKG------CRTGEAKLTKGFNLAARYIIHTVGPKYKTKYRTAAESSLYSCYRNVLQLAKEQGMASVGFCVITTQKRCYPLDDATHIALRTVRRF 193          
BLAST of FC931064 vs. ExPASy Swiss-Prot
Match: GDAP2_XENTR (Ganglioside-induced differentiation-associated protein 2 OS=Xenopus tropicalis PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.788e-16
Identity = 49/127 (38.58%), Postives = 69/127 (54.33%), Query Frame = 3
Query:  321 VNSANEKMLGGGGCDGAIHRAAGPELLEACYRVPEVGFGIRCPTGEARITPGFKLPASHVIHTVGPIYGVTINP--EASLRSAYKNSLSLAKANNIQYIAFPAISCGLYCYPHEEAATIAISTVKEF 695
            VN++NE +        +I R +GPEL E   ++        C TGEA++T GF L A ++IHTVGP Y        E+SL S Y+N L LAK   +  + F  I+    CYP E++  IA+ TV+ F
Sbjct:   73 VNTSNETLTDKNPVSDSIFRYSGPELSEEMQKLKG------CRTGEAKLTKGFNLAARYIIHTVGPKYKTKYRTAAESSLYSCYRNVLQLAKEQGMASVGFCVIATQKRCYPPEDSTHIALRTVRRF 193          
The following BLAST results are available for this feature:
BLAST of FC931064 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 66
Match NameE-valueIdentityDescription
Y995_THETN9.780e-2348.41UPF0189 protein TTE0995 OS=Thermoanaerobacter teng... [more]
Y6450_STRCO9.780e-2346.72UPF0189 protein SCO6450 OS=Streptomyces coelicolor... [more]
Y2902_LISIN2.845e-2246.92UPF0189 protein lin2902 OS=Listeria innocua GN=lin... [more]
Y1951_FUSNN3.716e-2249.21UPF0189 protein FN1951 OS=Fusobacterium nucleatum ... [more]
Y189_STRNO4.854e-2245.53UPF0189 protein in sno 5'region OS=Streptomyces no... [more]
Y2288_DEIRA1.412e-2146.51UPF0189 protein DR_2288 OS=Deinococcus radiodurans... [more]
Y189_ACISE7.749e-2044.35UPF0189 protein OS=Acinetobacter sp. (strain ED45-... [more]
GDAP2_NEMVE4.252e-1839.69Protein GDAP2 homolog OS=Nematostella vectensis GN... [more]
GDAP2_XENLA1.786e-1639.37Ganglioside-induced differentiation-associated pro... [more]
GDAP2_XENTR6.788e-1638.58Ganglioside-induced differentiation-associated pro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A07EF PostHarvP1 Citrus clementina cDNA clone C34101A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931064 ID=FC931064|Name=FC931064|organism=Citrus clementina|type=EST|length=708bp
GGAGCTTGATTGATCAGGGATTATGAATGCTTCCTCTACCAAAGGATCTT
TTTGAGAGTGCTTTTGGTAGTGCCTAAAGCGCTTTTAAGTAGCCAAGAGC
CATTGTGTCTATTGGTGTTTTCCTAGAGATCTTTTGACATTAGAAAGTGC
TTTTTGAACAAATAATTTATTGGTGTTTTTGCAAGAAGAACAATTGACTT
GAAAGTACTTTTTTGCAAAATCACTGGCAGCACACCTTACAGTTAATGAT
CGCTTGATTGAATAGGAAGGTTGGTGTTGAAAAGGGAAATTGCAATTGAT
TGAATGGTTGTTTGCTATAGGTTAATTCAGCCAATGAGAAAATGCTTGGA
GGTGGCGGTTGCGATGGAGCTATACATAGGGCTGCAGGACCAGAACTTCT
AGAAGCTTGTTATAGAGTTCCAGAAGTTGGATTTGGAATCCGTTGTCCCA
CAGGAGAAGCAAGAATTACACCAGGTTTTAAATTGCCTGCATCTCATGTG
ATTCACACTGTTGGCCCAATCTATGGTGTTACTATTAACCCTGAAGCTTC
CCTGAGAAGTGCGTACAAGAACAGCTTGAGCTTGGCCAAAGCGAATAACA
TTCAGTACATTGCTTTTCCTGCCATATCGTGTGGCTTATATTGTTATCCT
CATGAGGAAGCCGCCACAATAGCTATATCTACAGTCAAAGAATTTGCTAA
TGACTTTA
back to top