FC931067

Overview
NameFC931067
Unique NameFC931067
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length723
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: IP5PE_ARATH (Type II inositol-1,4,5-trisphosphate 5-phosphatase 14 OS=Arabidopsis thaliana GN=5PTASE14 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.375e-18
Identity = 55/153 (35.95%), Postives = 87/153 (56.86%), Query Frame = 1
Query:   28 SHDQIFWFGDLNYRL-NMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAYTRAEILLSDHRPVSSTFL----VQVEVLDHRKLKRALNVSSAVVHPD 471
            S D + +FGD NYRL  +   E R+ ++ + +D L   DQL +E++ G VF+G +E +I FPPTYK+E N     G +   GEKKR PAWCDR+++  +  + ++YT   +       VSST +    + V   DH+ ++  L+ +  + H D
Sbjct:  789 SADLVAFFGDFNYRLFGITYDEARDFISHRSFDWLREKDQLRQEMNEGKVFQGMREALITFPPTYKFEKNKPGLGGYD--SGEKKRIPAWCDRVIY--RDNQSISYTECSLKCP---VVSSTIMYEACMDVTESDHKPVRCKLHAN--IAHTD 932          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SYJ2_SCHPO (Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe GN=syj2 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.757e-18
Identity = 50/125 (40.00%), Postives = 70/125 (56.00%), Query Frame = 1
Query:   31 HDQIFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAYTRAEILLSDHRPVSSTFLVQV 405
            H  I W GD NYR++  + EVR+LV     DKL + DQL  E+  G VF G  E  + F PTYK++  ++ Y        +K+R P+W DRIL   K   +  Y   +I  SDHRPV +TF +++
Sbjct:  744 HTNILWMGDFNYRIDSDNEEVRKLVELDDLDKLASYDQLCTEMKKGTVFHGLVEPQLTFLPTYKFDNGTNDY-----DTSDKQRVPSWTDRIL-ATKSFTRNCYKSCDIRCSDHRPVFATFSLKI 862          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: PI5PA_RAT (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Rattus norvegicus GN=Inpp5j PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.518e-18
Identity = 54/165 (32.73%), Postives = 86/165 (52.12%), Query Frame = 1
Query:   31 HDQIFWFGDLNYRLNMMDTE-VRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKG----------------IKQLAY-TRAEILLSDHRPVSSTFLVQVEVLDHRKLKRALNVSSAVVHPD 471
            HD +FWFGDLN+R+   D   V+  +   +  +L   DQL+   ++  + +G++EG +NF PT+K+++ +++Y         KKR PAW DRILW  K                 + Q +Y +  E  +SDH+PV++ FL+Q    D   L R L V+     P+
Sbjct:  590 HDLVFWFGDLNFRIESYDLHFVKFAIDSNQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKY-----DTSAKKRKPAWTDRILWKVKAPSGGPSPSGRESHRLQVTQHSYRSHMEYTVSDHKPVAARFLLQFAFRDDVPLVR-LEVADEWARPE 748          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SHIP2_HUMAN (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens GN=INPPL1 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 9.819e-18
Identity = 52/128 (40.62%), Postives = 70/128 (54.69%), Query Frame = 1
Query:   40 IFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINS-DRYVGENPK-EGEKKRSPAWCDRILWLGKGIKQLAYT----RAEILLSDHRPVSSTFLVQV 405
            +FWFGDLNYRL+M   E+   +++K ++ L+  DQL+ E     VF  + E  I+FPPTY+YE  S D Y     K  G +   P+WCDRILW       +         +I+ SDH PV  TF V V
Sbjct:  602 LFWFGDLNYRLDMDIQEILNYISRKEFEPLLRVDQLNLEREKHKVFLRFSEEEISFPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIVTSDHSPVFGTFEVGV 729          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: PI5PA_MOUSE (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Mus musculus GN=Inpp5j PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.282e-17
Identity = 53/165 (32.12%), Postives = 86/165 (52.12%), Query Frame = 1
Query:   31 HDQIFWFGDLNYRLNMMDTE-VRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKG----------------IKQLAY-TRAEILLSDHRPVSSTFLVQVEVLDHRKLKRALNVSSAVVHPD 471
            HD +FWFGDLN+R+   D   V+  +   +  +L   DQL+   ++  + +G++EG +NF PT+K+++ +++Y         KKR PAW DRILW  K                 + Q +Y +  E  +SDH+PV++ F++Q    D   L R L V+     P+
Sbjct:  592 HDLVFWFGDLNFRIESYDLHFVKFAIDSNQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKY-----DTSAKKRKPAWTDRILWKVKAPSGGPSPSGRESHRLQVTQHSYRSHMEYTVSDHKPVAAQFILQFAFRDDVPLVR-LEVADEWARPE 750          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SHP2B_DANRE (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2B OS=Danio rerio GN=inppl1b PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.675e-17
Identity = 49/130 (37.69%), Postives = 77/130 (59.23%), Query Frame = 1
Query:   34 DQIFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINS-DRYVGENPK-EGEKKRSPAWCDRILWLGKGIKQLAYT----RAEILLSDHRPVSSTFLVQV 405
            + +FW GDLNYRL++   ++ + V+++ +++L+ +DQL++E H    F  +KE  I FPPTY+YE  S D Y+ +  K  G +   P+WCDR+LW       +  T      +I  S+H PV +TF V V
Sbjct:  580 NHLFWCGDLNYRLDLDALDILKHVSKREFEELMCADQLTRERHKRKAFFNFKEEKIMFPPTYRYERGSRDCYLWQKYKSSGVQVNGPSWCDRVLWKSYPESHVICTSYGCTDDIFTSEHSPVFATFEVGV 709          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SHIP2_RAT (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus GN=Inppl1 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.187e-17
Identity = 51/128 (39.84%), Postives = 70/128 (54.69%), Query Frame = 1
Query:   40 IFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINS-DRYVGENPK-EGEKKRSPAWCDRILWLGKGIKQLAYT----RAEILLSDHRPVSSTFLVQV 405
            +FWFGDLNYRL+M   E+   ++++ ++ L+  DQL+ E     VF  + E  I+FPPTY+YE  S D Y     K  G +   P+WCDRILW       +         +I+ SDH PV  TF V V
Sbjct:  603 LFWFGDLNYRLDMDIQEILNYISRREFEPLLRVDQLNLEREKHKVFLRFSEEEISFPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIVTSDHSPVFGTFEVGV 730          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SHIP2_MOUSE (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus GN=Inppl1 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.187e-17
Identity = 51/128 (39.84%), Postives = 70/128 (54.69%), Query Frame = 1
Query:   40 IFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINS-DRYVGENPK-EGEKKRSPAWCDRILWLGKGIKQLAYT----RAEILLSDHRPVSSTFLVQV 405
            +FWFGDLNYRL+M   E+   ++++ ++ L+  DQL+ E     VF  + E  I+FPPTY+YE  S D Y     K  G +   P+WCDRILW       +         +I+ SDH PV  TF V V
Sbjct:  603 LFWFGDLNYRLDMDIQEILNYISRREFEPLLRVDQLNLEREKHKVFLRFSEEEISFPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIVTSDHSPVFGTFEVGV 730          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: IP5PD_ARATH (Type I inositol-1,4,5-trisphosphate 5-phosphatase 13 OS=Arabidopsis thaliana GN=5PTASE13 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.365e-17
Identity = 50/144 (34.72%), Postives = 74/144 (51.39%), Query Frame = 1
Query:   34 DQIFWFGDLNYRL-NMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAYTR---------------AEILLSDHRPVSSTFLVQVEVLD 417
            D + +FGD NYRL  +   E R+ ++Q+ +D L   DQL  E+  G VF+G +E +I FPPTYK+E N     G +   GEKKR PAWCDR+++        + +                 ++  SDH+PV   F   +  +D
Sbjct:  782 DMVAFFGDFNYRLFGITYDEARDFISQRSFDWLRERDQLRAEMKVGKVFQGMREALITFPPTYKFERNRSGLGGYD--SGEKKRIPAWCDRVIYRDTQSSPFSESNLQCPVVSSVIMYEACMDVTESDHKPVRCKFHATIAHVD 923          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: YE8A_SCHPO (Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe GN=SPAC9G1.10c PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 1.418e-16
Identity = 49/123 (39.84%), Postives = 70/123 (56.91%), Query Frame = 1
Query:   31 HDQIFWFGDLNYRLNMMDTEVRELVAQKRWDKLINSDQL--SKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKG--IKQLAYTRAEILLSDHRPVSS 387
            H+     GDLNYR+N +  +  +L+ +     L+ SDQL   ++ ++G     + E  I F PTYKY+++S++Y        EKKR PAWCDRI + G    I    YTR E+  SDHRPVS+
Sbjct: 1002 HEVCVLHGDLNYRINTLRPKALDLIKKNDIKTLLQSDQLLVERKRNAGFRLRTFTEPEITFAPTYKYDVHSEQY-----DSSEKKRVPAWCDRICYRGSPDYISAENYTRYELKASDHRPVSA 1119          
The following BLAST results are available for this feature:
BLAST of FC931067 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
IP5PE_ARATH3.375e-1835.95Type II inositol-1,4,5-trisphosphate 5-phosphatase... [more]
SYJ2_SCHPO5.757e-1840.00Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Sc... [more]
PI5PA_RAT7.518e-1832.73Phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
SHIP2_HUMAN9.819e-1840.63Phosphatidylinositol-3,4,5-trisphosphate 5-phospha... [more]
PI5PA_MOUSE1.282e-1732.12Phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
SHP2B_DANRE1.675e-1737.69Phosphatidylinositol-3,4,5-trisphosphate 5-phospha... [more]
SHIP2_RAT2.187e-1739.84Phosphatidylinositol-3,4,5-trisphosphate 5-phospha... [more]
SHIP2_MOUSE2.187e-1739.84Phosphatidylinositol-3,4,5-trisphosphate 5-phospha... [more]
IP5PD_ARATH6.365e-1734.72Type I inositol-1,4,5-trisphosphate 5-phosphatase ... [more]
YE8A_SCHPO1.418e-1639.84Probable inositol polyphosphate 5-phosphatase C9G1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A10EF PostHarvP1 Citrus clementina cDNA clone C34101A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931067 ID=FC931067|Name=FC931067|organism=Citrus clementina|type=EST|length=723bp
GGAACAGATCAACCACAGACATCTCCATCTCATGATCAGATATTCTGGTT
TGGGGATTTGAATTATCGTCTCAATATGATGGACACAGAAGTTCGGGAGC
TTGTTGCTCAGAAGCGGTGGGATAAGCTTATCAACAGTGATCAGCTAAGC
AAAGAACTCCACAGTGGGCATGTGTTTGAGGGATGGAAAGAGGGAGTGAT
AAACTTTCCACCAACTTACAAATACGAAATAAATTCTGATAGATATGTTG
GTGAGAACCCAAAAGAAGGGGAGAAGAAAAGATCTCCAGCATGGTGTGAT
CGTATACTTTGGCTAGGAAAAGGCATAAAACAACTTGCTTACACGCGGGC
AGAGATACTACTCTCTGATCATCGGCCTGTTAGTTCAACGTTCTTGGTTC
AAGTTGAGGTCTTAGACCATCGAAAGTTGAAGAGAGCACTCAATGTCAGC
TCTGCAGTAGTACATCCTGATATTTTCTTAGATGAAGATGGGGAACTAGA
GCTTCAGCAATTACCAGGTAGAATACCAGGGGACCGCAAGTTGTTTGGCT
AACATTAGAAGTTGACATCAAATCGATATACGGGTATCGACATCCACCTT
CAGGTTGAAGCACGAACAAAATCAAATCCTTGTGACAATAGCAAGGAAAA
GAAGTGTTCTGTATAGCCTTGAGTCACATAATACTTGATACATAGTCAAT
ATATAGATATAGCAATGTGCCAA
back to top