FC931067

Overview
NameFC931067
Unique NameFC931067
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length723
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SHIP1_XENLA (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 OS=Xenopus laevis GN=inpp5d PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 9.190e-16
Identity = 53/135 (39.26%), Postives = 71/135 (52.59%), Query Frame = 1
Query:   34 DQIFWFGDLNYRLNMMDTEVRELVA---QKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINS-DRYVGENPK-EGEKKRSPAWCDRILWLGKGIKQLAY------TRAEILLSDHRPVSSTFLVQV 405
            + +FW GDLNYRL + +TE   ++    Q++  +L+  DQL+ E     +F  + E  I FPPTY+YE  S +RY     K  G K   P+WCDRILW  K   Q+           +I  SDH PV  TF V V
Sbjct:  574 NHLFWLGDLNYRLQLPNTEAENIIQKIKQQQHQELLPHDQLNLERRESLIFFQFHEEEITFPPTYRYERGSRERYCYTKQKATGIKYNLPSWCDRILW--KSYPQMHILCQSYGCTDDITTSDHSPVFGTFQVGV 706          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SHIP1_HUMAN (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens GN=INPP5D PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 3.492e-15
Identity = 47/127 (37.01%), Postives = 72/127 (56.69%), Query Frame = 1
Query:   40 IFWFGDLNYRLNMMDTEVRELVA---QKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYE-INSDRYVGENPK-EGEKKRSPAWCDRILW----LGKGIKQLAYTRAEILLSDHRPVSSTF 393
            +FWFGDLNYR+++   E   ++    Q+++  L++ DQL  E     VF  ++E  I F PTY++E +  D+Y     K  G K   P+WCDR+LW    L   + Q   + ++I+ SDH PV +TF
Sbjct:  582 LFWFGDLNYRVDLPTWEAETIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATF 708          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: INP5E_MOUSE (72 kDa inositol polyphosphate 5-phosphatase OS=Mus musculus GN=Inpp5e PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.327e-14
Identity = 47/131 (35.88%), Postives = 73/131 (55.73%), Query Frame = 1
Query:   34 DQIFWFGDLNYRLNMMDTEVRELVAQKRWDK---LINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGK---GIKQLAYTRAE-ILLSDHRPVSSTFLVQV 405
            D++FWFGD N+RL+     V   + QK       L+  DQL++E+  G +F G++E  I+F P+YK++I  D Y         K+R+P++ DR+L+  +    I  + Y+    I  SDHRPV   F V+V
Sbjct:  473 DEVFWFGDFNFRLSGGRVAVEAFLKQKPEVDVLALLQHDQLTREMKKGSIFRGFEEAEIHFLPSYKFDIGKDTY-----DSTSKQRTPSYTDRVLYKSRHKGDICPMKYSSCPGIKTSDHRPVYGLFQVKV 598          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: INP5E_PANTR (72 kDa inositol polyphosphate 5-phosphatase OS=Pan troglodytes GN=INPP5E PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.733e-14
Identity = 48/131 (36.64%), Postives = 75/131 (57.25%), Query Frame = 1
Query:   34 DQIFWFGDLNYRLNMMDTEVRELVAQKRW---DKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGK---GIKQLAYTRAE-ILLSDHRPVSSTFLVQV 405
            D++FWFGD N+RL+   T V  L+ Q        L+  DQL +E+  G +F+G++E  I+F P+YK++I  D Y         K+R+P++ DR+L+  +    I  ++Y+    I  SDHRPV   F V+V
Sbjct:  470 DEVFWFGDFNFRLSGGRTVVDALLCQGLVVDVPALLQHDQLIREMRKGSIFKGFQEPDIHFLPSYKFDIGKDTY-----DSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKV 595          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: INP5E_HUMAN (72 kDa inositol polyphosphate 5-phosphatase OS=Homo sapiens GN=INPP5E PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.733e-14
Identity = 48/131 (36.64%), Postives = 75/131 (57.25%), Query Frame = 1
Query:   34 DQIFWFGDLNYRLNMMDTEVRELVAQKRW---DKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGK---GIKQLAYTRAE-ILLSDHRPVSSTFLVQV 405
            D++FWFGD N+RL+   T V  L+ Q        L+  DQL +E+  G +F+G++E  I+F P+YK++I  D Y         K+R+P++ DR+L+  +    I  ++Y+    I  SDHRPV   F V+V
Sbjct:  470 DEVFWFGDFNFRLSGGRTVVDALLCQGLVVDVPALLQHDQLIREMRKGSIFKGFQEPDIHFLPSYKFDIGKDTY-----DSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKV 595          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: IP5PB_ARATH (Type I inositol-1,4,5-trisphosphate 5-phosphatase 11 OS=Arabidopsis thaliana GN=At1g47510 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.264e-14
Identity = 45/132 (34.09%), Postives = 66/132 (50.00%), Query Frame = 1
Query:   13 PQTSPSHDQIFWFGDLNYRL-NMMDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAYTR------AEILLSDHRPVSS 387
            P+     D   W GDLNYR+ ++ +  VR L+       L++ DQL +E   G +F+G+ EG + F PTYKY + S  Y         K R PAW DRIL+  +    +  T        ++  SDH+PV +
Sbjct:  199 PRDKRKRDLTVWLGDLNYRIQDVSNHPVRSLIQNHLQSVLVSKDQLLQEAERGEIFKGYSEGTLGFKPTYKYNVGSSDY-----DTSHKIRVPAWTDRILFKIQDTDNIQATLHSYDSIDQVYGSDHKPVKA 325          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: INP5K_MOUSE (Inositol polyphosphate 5-phosphatase K OS=Mus musculus GN=Inpp5k PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.956e-14
Identity = 49/153 (32.03%), Postives = 75/153 (49.02%), Query Frame = 1
Query:   31 HDQIFWFGDLNYRLNMMDTE-VRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILW------------------------LGKGIKQLAYTRAEILLSDHRPVSSTFLVQVEVL 414
            HD I WFGD+N+R+       V+E + +K + +L   DQL     +  +   ++EG + FPPTYK++ +S+ Y        EKKR PAW DRILW                        L   +  +AY+     +SDH+PV+ TF +++  L
Sbjct:  202 HDLILWFGDMNFRIEDFGLLFVQESITRKYYKELWEKDQLFIAKKNDQLLREFQEGPLLFPPTYKFDRHSNNY-----DTSEKKRKPAWTDRILWRLKRQPSQASPLASSVPTSYFLLTLKNYVSHMAYS-----ISDHKPVTGTFDLELNPL 344          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SHIP1_RAT (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 OS=Rattus norvegicus GN=Inpp5d PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.861e-14
Identity = 46/127 (36.22%), Postives = 69/127 (54.33%), Query Frame = 1
Query:   40 IFWFGDLNYRLNMMDTEVRELVA---QKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYE-INSDRYVGENPK-EGEKKRSPAWCDRILW----LGKGIKQLAYTRAEILLSDHRPVSSTF 393
            +FW GDLNYR+ +   E   ++    Q+++  L+  DQL  E     VF  ++E  I F PTY++E +  D+Y     K  G K   P+WCDR+LW    L   + Q   + ++I+ SDH PV +TF
Sbjct:  584 LFWLGDLNYRVELPTWEAEAIIQKIKQQQYSDLLAHDQLLLERKEQEVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATF 710          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: INP5K_HUMAN (Inositol polyphosphate 5-phosphatase K OS=Homo sapiens GN=INPP5K PE=1 SV=3)

HSP 1 Score: 78.5666 bits (192), Expect = 3.861e-14
Identity = 51/147 (34.69%), Postives = 72/147 (48.98%), Query Frame = 1
Query:   31 HDQIFWFGDLNYRLNMMDTE-VRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGK-----------------GIKQLAY-TRAEILLSDHRPVSSTFLVQVEVL 414
            HD I WFGD+N+R+       VRE +  + +  L   DQLS       +   ++EG + FPPTYK++ NS+ Y        EKKR PAW DRILW  K                  +    Y +     +SDH+PVS TF ++++ L
Sbjct:  184 HDLIIWFGDMNFRIEDFGLHFVRESIKNRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDY-----DTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPL 325          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: SHIP1_MOUSE (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 OS=Mus musculus GN=Inpp5d PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 5.043e-14
Identity = 46/127 (36.22%), Postives = 69/127 (54.33%), Query Frame = 1
Query:   40 IFWFGDLNYRLNMMDTEVRELVA---QKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYE-INSDRYVGENPK-EGEKKRSPAWCDRILW----LGKGIKQLAYTRAEILLSDHRPVSSTF 393
            +FW GDLNYR+ +   E   ++    Q+++  L+  DQL  E     VF  ++E  I F PTY++E +  D+Y     K  G K   P+WCDR+LW    L   + Q   + ++I+ SDH PV +TF
Sbjct:  585 LFWLGDLNYRVELPTWEAEAIIQKIKQQQYSDLLAHDQLLLERKDQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATF 711          
The following BLAST results are available for this feature:
BLAST of FC931067 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
SHIP1_XENLA9.190e-1639.26Phosphatidylinositol-3,4,5-trisphosphate 5-phospha... [more]
SHIP1_HUMAN3.492e-1537.01Phosphatidylinositol-3,4,5-trisphosphate 5-phospha... [more]
INP5E_MOUSE1.327e-1435.8872 kDa inositol polyphosphate 5-phosphatase OS=Mus... [more]
INP5E_PANTR1.733e-1436.6472 kDa inositol polyphosphate 5-phosphatase OS=Pan... [more]
INP5E_HUMAN1.733e-1436.6472 kDa inositol polyphosphate 5-phosphatase OS=Hom... [more]
IP5PB_ARATH2.264e-1434.09Type I inositol-1,4,5-trisphosphate 5-phosphatase ... [more]
INP5K_MOUSE2.956e-1432.03Inositol polyphosphate 5-phosphatase K OS=Mus musc... [more]
SHIP1_RAT3.861e-1436.22Phosphatidylinositol-3,4,5-trisphosphate 5-phospha... [more]
INP5K_HUMAN3.861e-1434.69Inositol polyphosphate 5-phosphatase K OS=Homo sap... [more]
SHIP1_MOUSE5.043e-1436.22Phosphatidylinositol-3,4,5-trisphosphate 5-phospha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A10EF PostHarvP1 Citrus clementina cDNA clone C34101A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931067 ID=FC931067|Name=FC931067|organism=Citrus clementina|type=EST|length=723bp
GGAACAGATCAACCACAGACATCTCCATCTCATGATCAGATATTCTGGTT
TGGGGATTTGAATTATCGTCTCAATATGATGGACACAGAAGTTCGGGAGC
TTGTTGCTCAGAAGCGGTGGGATAAGCTTATCAACAGTGATCAGCTAAGC
AAAGAACTCCACAGTGGGCATGTGTTTGAGGGATGGAAAGAGGGAGTGAT
AAACTTTCCACCAACTTACAAATACGAAATAAATTCTGATAGATATGTTG
GTGAGAACCCAAAAGAAGGGGAGAAGAAAAGATCTCCAGCATGGTGTGAT
CGTATACTTTGGCTAGGAAAAGGCATAAAACAACTTGCTTACACGCGGGC
AGAGATACTACTCTCTGATCATCGGCCTGTTAGTTCAACGTTCTTGGTTC
AAGTTGAGGTCTTAGACCATCGAAAGTTGAAGAGAGCACTCAATGTCAGC
TCTGCAGTAGTACATCCTGATATTTTCTTAGATGAAGATGGGGAACTAGA
GCTTCAGCAATTACCAGGTAGAATACCAGGGGACCGCAAGTTGTTTGGCT
AACATTAGAAGTTGACATCAAATCGATATACGGGTATCGACATCCACCTT
CAGGTTGAAGCACGAACAAAATCAAATCCTTGTGACAATAGCAAGGAAAA
GAAGTGTTCTGTATAGCCTTGAGTCACATAATACTTGATACATAGTCAAT
ATATAGATATAGCAATGTGCCAA
back to top