FC931067

Overview
NameFC931067
Unique NameFC931067
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length723
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: INP5E_RAT (72 kDa inositol polyphosphate 5-phosphatase OS=Rattus norvegicus GN=Inpp5e PE=2 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 5.043e-14
Identity = 46/131 (35.11%), Postives = 73/131 (55.73%), Query Frame = 1
Query:   34 DQIFWFGDLNYRLNMMDTEVRELVAQKRWDK---LINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGK---GIKQLAYTRAE-ILLSDHRPVSSTFLVQV 405
            D++FWFGD N+RL+     V   + Q        L+  DQL++E+  G +F+G++E  I+F P+YK++I  D Y         K+R+P++ DR+L+  +    I  + Y+    I  SDHRPV   F V+V
Sbjct:  473 DEVFWFGDFNFRLSGGRVAVEAFLKQDPEVDVLALLQHDQLTREMKKGSIFKGFEEAEIHFLPSYKFDIGKDTY-----DSTSKQRTPSYTDRVLYKSRHKGDICPMKYSSCPGIKTSDHRPVYGLFRVKV 598          
BLAST of FC931067 vs. ExPASy Swiss-Prot
Match: YLJ7_CAEEL (Uncharacterized protein C50C3.7 OS=Caenorhabditis elegans GN=C50C3.7 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.052e-11
Identity = 42/121 (34.71%), Postives = 64/121 (52.89%), Query Frame = 1
Query:   43 FWFGDLNYRLNM-MDTEVRELVAQKRWDKLINSDQLSKELHSGHVFEGWKEGVINFPPTYKYEINSDRYVGENPKEGEKKRSPAWCDRILWLGKGIKQLAYT-RAEILLSDHRPVSSTFLV 399
            FWFGD N+R+   ++T +R++      + L   +QL + L     F G+ E  + F PTY+  + +         E + KR P+W DRIL+ G GI  L+YT   + + SDH PV + F V
Sbjct:  169 FWFGDFNFRVEEDVNTVIRKIKNGTHLELLDTREQLKRALVERDAFIGFHEQPVTFEPTYRVTVGTT--------EQDGKRVPSWTDRILYKGDGITGLSYTNNKKAVASDHLPVVAMFRV 281          
The following BLAST results are available for this feature:
BLAST of FC931067 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
INP5E_RAT5.043e-1435.1172 kDa inositol polyphosphate 5-phosphatase OS=Rat... [more]
YLJ7_CAEEL1.052e-1134.71Uncharacterized protein C50C3.7 OS=Caenorhabditis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A10EF PostHarvP1 Citrus clementina cDNA clone C34101A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931067 ID=FC931067|Name=FC931067|organism=Citrus clementina|type=EST|length=723bp
GGAACAGATCAACCACAGACATCTCCATCTCATGATCAGATATTCTGGTT
TGGGGATTTGAATTATCGTCTCAATATGATGGACACAGAAGTTCGGGAGC
TTGTTGCTCAGAAGCGGTGGGATAAGCTTATCAACAGTGATCAGCTAAGC
AAAGAACTCCACAGTGGGCATGTGTTTGAGGGATGGAAAGAGGGAGTGAT
AAACTTTCCACCAACTTACAAATACGAAATAAATTCTGATAGATATGTTG
GTGAGAACCCAAAAGAAGGGGAGAAGAAAAGATCTCCAGCATGGTGTGAT
CGTATACTTTGGCTAGGAAAAGGCATAAAACAACTTGCTTACACGCGGGC
AGAGATACTACTCTCTGATCATCGGCCTGTTAGTTCAACGTTCTTGGTTC
AAGTTGAGGTCTTAGACCATCGAAAGTTGAAGAGAGCACTCAATGTCAGC
TCTGCAGTAGTACATCCTGATATTTTCTTAGATGAAGATGGGGAACTAGA
GCTTCAGCAATTACCAGGTAGAATACCAGGGGACCGCAAGTTGTTTGGCT
AACATTAGAAGTTGACATCAAATCGATATACGGGTATCGACATCCACCTT
CAGGTTGAAGCACGAACAAAATCAAATCCTTGTGACAATAGCAAGGAAAA
GAAGTGTTCTGTATAGCCTTGAGTCACATAATACTTGATACATAGTCAAT
ATATAGATATAGCAATGTGCCAA
back to top