FC931069

Overview
NameFC931069
Unique NameFC931069
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length668
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:1..670. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH2_ARATH (Adenosylhomocysteinase 2 OS=Arabidopsis thaliana GN=SAHH2 PE=1 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 6.361e-82
Identity = 145/180 (80.56%), Postives = 156/180 (86.67%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            MAL V+K++SGRE+KVKD+SQADFGRLEIELAEVEMPGL++C  EFGPSQP KGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEI+ K G  PDP STDN EFQIVL+I
Sbjct:    1 MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSI 180          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_SOLLC (Adenosylhomocysteinase OS=Solanum lycopersicum GN=SAHH PE=2 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 4.123e-81
Identity = 146/180 (81.11%), Postives = 154/180 (85.56%), Query Frame = 1
Query:  127 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            MAL V+K+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMA RAEFGPSQP KGAKIT SLHMTIQTA LIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STDN EFQ+VLTI
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPVKGAKITCSLHMTIQTAFLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTVPDPTSTDNVEFQLVLTI 180          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_STRGG (Adenosylhomocysteinase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ahcY PE=3 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.132e-53
Identity = 106/180 (58.89%), Postives = 127/180 (70.56%), Query Frame = 1
Query:  160 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW--GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            ++FKV DLS A FGR EI LAE EMPGLM+ R EF  +QP  GA+ITGSLHMT+QTAVLIETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWWCTE+AL W   P GGP++I+DDGGDATLL+H+GV+    +EK G  PDP++ D+ E+  +LT+
Sbjct:    8 QDFKVADLSLAPFGRKEITLAEHEMPGLMSIRKEFAAAQPLAGARITGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAVGPNGTPEAPAGVPVFAWKGETLEEYWWCTEQALTWPNTPTGGPNMILDDGGDATLLVHKGVE----FEKAGAAPDPSTADSEEYAHILTL 183          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_STRAW (Adenosylhomocysteinase OS=Streptomyces avermitilis GN=ahcY PE=3 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.170e-51
Identity = 102/180 (56.67%), Postives = 127/180 (70.56%), Query Frame = 1
Query:  160 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW--GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            ++FKV DLS A+FGR EI LAE EMPGLM+ R E+  +QP  GA++TGSLHMT+QTAVLIETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWWCTE+AL W   P GGP++I+DDGGDATLL+H+GV+    YEK GK+P   + ++ E +++L +
Sbjct:    8 QDFKVADLSLAEFGRKEITLAEHEMPGLMSIRKEYAEAQPLAGARVTGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAVGPNGTPDNPQGVPVFAWKGETLEEYWWCTEQALTWPNTPTGGPNMILDDGGDATLLVHKGVE----YEKDGKVPSVDTAESDEHRVILEL 183          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_STRAA (Adenosylhomocysteinase OS=Streptomyces argillaceus GN=ahcY PE=3 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.170e-51
Identity = 103/184 (55.98%), Postives = 127/184 (69.02%), Query Frame = 1
Query:  148 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW--GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            SA   +FKV DLS A+FGR EI LAE EMPGLM+ R E+  +QP  GA++TGSLHMT+QTAVLIETL ALGA+VRW SCNIFSTQ H                       WKGETL+EYWWCTE+AL W   P GGP++I+DDGGDATLL+H+GV+    YEK GK+P   + +N E +++L +
Sbjct:    2 SADFTDFKVADLSLAEFGRKEITLAEHEMPGLMSIRREYAEAQPLAGARVTGSLHMTVQTAVLIETLVALGAQVRWASCNIFSTQGHAAAAIAVGPDGTPDNPRAVPVFAWKGETLEEYWWCTEQALTWPDSPTGGPNMILDDGGDATLLVHKGVE----YEKDGKVPSVDTAENDEHRVILEL 181          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_STRCO (Adenosylhomocysteinase OS=Streptomyces coelicolor GN=ahcY PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.528e-51
Identity = 103/180 (57.22%), Postives = 126/180 (70.00%), Query Frame = 1
Query:  160 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW--GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            ++FKV DLS A FGR EI LAE EMPGLMA R E+  +QP  GA++TGSLHMT+QTAVLIETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWWCTE+AL W   P GGP++I+DDGGDATLL+H+GV+    YEK GK+P   + ++ E +++L +
Sbjct:    8 QDFKVADLSLAAFGRKEITLAEHEMPGLMAIRKEYAEAQPLAGARVTGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAVGPNGTPDNPQGVPVFAWKGETLEEYWWCTEQALTWPNTPTGGPNMILDDGGDATLLVHKGVE----YEKDGKVPSVDTAESDEHRVILEL 183          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_DESAD (Adenosylhomocysteinase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=ahcY PE=3 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.606e-51
Identity = 104/173 (60.12%), Postives = 122/173 (70.52%), Query Frame = 1
Query:  145 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            K  S  ++KV D+S AD+G  E++L+E EMPGLM+ R ++G  +P KG K+ GSLHMTIQTA+LIETL ALGA++RW SCNIFSTQDH               WKGETL+EYWWCTE+AL W  G GPDLIVDDGGDATLLIH GVKA    EK   + D   TDN EFQ VL
Sbjct:    3 KVDSKLDYKVADISLADWGNKEMQLSEREMPGLMSIREKYGKEKPLKGLKVMGSLHMTIQTAMLIETLHALGADIRWASCNIFSTQDHAAAAIAANGTAKVFAWKGETLEEYWWCTEQALTWPDGSGPDLIVDDGGDATLLIHHGVKA----EKDASILD-EKTDNKEFQCVL 170          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_STRAZ (Adenosylhomocysteinase OS=Streptomyces atroolivaceus GN=ahcY PE=3 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.404e-51
Identity = 102/172 (59.30%), Postives = 121/172 (70.35%), Query Frame = 1
Query:  142 QKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIV 657
            Q  A   +FKV DLS A FGR EI LAE EMPGLM+ R E+  +QP  GA+ITGSLHMT+QTAVLIETL ALGA+VRW SCNI+STQDH              WKGETL+EYWWCTE+AL W    GP++I+DDGGDATLL+H+GV+    Y KTG LP+    +N E  +V
Sbjct:    4 QPPADFTDFKVADLSLAAFGRKEITLAEHEMPGLMSIREEYAAAQPLAGARITGSLHMTVQTAVLIETLVALGADVRWVSCNIYSTQDHAAAAIAAAGIPVFAWKGETLEEYWWCTEQALTWPGHTGPNMILDDGGDATLLVHKGVE----YRKTGILPE---AENEELAVV 168          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_DESDG (Adenosylhomocysteinase OS=Desulfovibrio desulfuricans (strain G20) GN=ahcY PE=3 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.689e-50
Identity = 104/170 (61.18%), Postives = 121/170 (71.18%), Query Frame = 1
Query:  163 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE---IYEKTGKLPDPASTDNAEFQIVL 660
            E KVKDLSQADFG  E++L+E EMPGLM   A+ G  +P KG K+TGSLHMTIQTA+LI+TL  LGA++RW SCNIFSTQDH               WKGETL+EYWWCTE AL W  G GPDLIVDDGGDAT+LIH+GV+AE+   + EK        S DN EFQIV+
Sbjct:   15 ENKVKDLSQADFGYKEMQLSEREMPGLMELIAKHGAEKPLKGLKVTGSLHMTIQTAMLIKTLYELGADIRWASCNIFSTQDHAAAAIADSGMAKVFAWKGETLEEYWWCTEMALTWPDGSGPDLIVDDGGDATMLIHKGVEAEKNPALLEK--------SYDNKEFQIVM 176          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_PLAF7 (Adenosylhomocysteinase OS=Plasmodium falciparum (isolate 3D7) GN=PFE1050w PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 2.882e-50
Identity = 94/169 (55.62%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  169 KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPG--GGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            KVKD+S A FG++++E++E EMPGLM  R E+G  QP K AKITG LHMT++ A+LIETL  LGA++RWCSCNI+ST D+               WK ETL+EYWWC E AL WG G   GPD+IVDDGGDATLL+H+GV+ E++YE+   LPDP    N E +  LT+
Sbjct:    7 KVKDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIETLQKLGAQIRWCSCNIYSTADYAAAAVSTLENVTVFAWKNETLEEYWWCVESALTWGDGDDNGPDMIVDDGGDATLLVHKGVEYEKLYEEKNILPDPEKAKNEEERCFLTL 175          
The following BLAST results are available for this feature:
BLAST of FC931069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH2_ARATH6.361e-8280.56Adenosylhomocysteinase 2 OS=Arabidopsis thaliana G... [more]
SAHH_SOLLC4.123e-8181.11Adenosylhomocysteinase OS=Solanum lycopersicum GN=... [more]
SAHH_STRGG2.132e-5358.89Adenosylhomocysteinase OS=Streptomyces griseus sub... [more]
SAHH_STRAW1.170e-5156.67Adenosylhomocysteinase OS=Streptomyces avermitilis... [more]
SAHH_STRAA1.170e-5155.98Adenosylhomocysteinase OS=Streptomyces argillaceus... [more]
SAHH_STRCO1.528e-5157.22Adenosylhomocysteinase OS=Streptomyces coelicolor ... [more]
SAHH_DESAD2.606e-5160.12Adenosylhomocysteinase OS=Desulfovibrio salexigens... [more]
SAHH_STRAZ3.404e-5159.30Adenosylhomocysteinase OS=Streptomyces atroolivace... [more]
SAHH_DESDG1.689e-5061.18Adenosylhomocysteinase OS=Desulfovibrio desulfuric... [more]
SAHH_PLAF72.882e-5055.62Adenosylhomocysteinase OS=Plasmodium falciparum (i... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A12EF PostHarvP1 Citrus clementina cDNA clone C34101A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931069 ID=FC931069|Name=FC931069|organism=Citrus clementina|type=EST|length=668bp
GGCTCACACCCACTCTATCTCTCTCGCTTGTACAATCATTCACTTTGTTT
GGTTGGTTTCCAAAGAGAGAGTAGAGTGCCCTCTCTTCCTTCTTCCTTTT
AGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAATCC
GCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTTCGG
CCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGGCTT
GCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATCACC
GGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCTCAC
CGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAACCC
AAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTTGCC
TGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGCCCT
GGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTGGTG
ACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTACGAG
AAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACAACGCCGAGTTTCA
GATTGTTTTGACTATCAT
back to top