FC931069

Overview
NameFC931069
Unique NameFC931069
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length668
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:1..670. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCMM (Adenosylhomocysteinase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.133e-46
Identity = 95/179 (53.07%), Postives = 120/179 (67.04%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGP-DLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGE+L+EYWWC E+ L W     P ++I+DDGGDAT+L+  G++    YEK G +P     D+AE+++ L
Sbjct:   14 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPKGVPVFAWKGESLEEYWWCAEQMLTWPDSDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDSAEWKVFL 188          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCLE (Adenosylhomocysteinase OS=Mycobacterium leprae GN=ahcY PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.525e-46
Identity = 97/181 (53.59%), Postives = 121/181 (66.85%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +G +FKV DLS A+FGR E++LAE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  GV+    YEK G +P     D+AE+++ L +
Sbjct:   14 NGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMILDDGGDATMLVLRGVQ----YEKAGVVPPAEVDDSAEWKVFLNL 190          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCLB (Adenosylhomocysteinase OS=Mycobacterium leprae (strain Br4923) GN=ahcY PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.525e-46
Identity = 97/181 (53.59%), Postives = 121/181 (66.85%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +G +FKV DLS A+FGR E++LAE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  GV+    YEK G +P     D+AE+++ L +
Sbjct:   14 NGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMILDDGGDATMLVLRGVQ----YEKAGVVPPAEVDDSAEWKVFLNL 190          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_PELLD (Adenosylhomocysteinase OS=Pelodictyon luteolum (strain DSM 273) GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.306e-46
Identity = 88/146 (60.27%), Postives = 107/146 (73.29%), Query Frame = 1
Query:  151 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            A+   +KV D+S A++GR EI++AE EMPGLMA R ++   +P KGA++ GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGETL++YWWCT + LD+G G GP+LIVDDGGDATL+I  G K E
Sbjct:    5 ATALAYKVADISLAEWGRKEIDIAEKEMPGLMAIRKKYAGQKPLKGARVAGSLHMTIQTAVLIETLVDLGADVRWASCNIFSTQDHAAAAIAATGVPVFAWKGETLEDYWWCTRQILDFGDGQGPNLIVDDGGDATLMIILGYKIE 150          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_PELPB (Adenosylhomocysteinase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.624e-46
Identity = 92/152 (60.53%), Postives = 107/152 (70.39%), Query Frame = 1
Query:  163 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLP 618
            ++KV DLS A++GR EI++AE EMPGLMA R ++    P KGA+I GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH              WKGETL+EYWWCT + L++  G GP+LIVDDGGDATL+I  G K E   E   K P
Sbjct:    9 DYKVADLSLAEWGRKEIDVAEKEMPGLMATRRKYAGQYPLKGARIAGSLHMTIQTAVLIETLVELGAEVRWASCNIFSTQDHAAAAIAKSGVPVFAWKGETLEEYWWCTRQILEFEGGKGPNLIVDDGGDATLMIILGYKIENNPELLEKAP 160          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCBO (Adenosylhomocysteinase OS=Mycobacterium bovis GN=ahcY PE=1 SV=3)

HSP 1 Score: 184.111 bits (466), Expect = 5.624e-46
Identity = 96/181 (53.04%), Postives = 119/181 (65.75%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  G++    YEK G +P     D AE++I L +
Sbjct:   17 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDPAEWKIFLNL 193          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_DESVM (Adenosylhomocysteinase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.624e-46
Identity = 91/165 (55.15%), Postives = 115/165 (69.70%), Query Frame = 1
Query:  169 KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            KV D++ ADFG  E++L+E E+PGLM     +G S+P KG ++TGSLHMTIQTA+LI+TL  LGA++RW SCNIFSTQDH               WKGETL++YWWCTE AL W  G GPDL+VDDGGDATL+IH+GV+ E   E   +     + DN EFQI++
Sbjct:   17 KVADMALADFGHKEMQLSEREVPGLMELIRMYGVSKPLKGLRVTGSLHMTIQTAMLIKTLYELGADIRWASCNIFSTQDHAAAAIADSGMAKVFAWKGETLEDYWWCTEMALTWPDGSGPDLLVDDGGDATLMIHKGVEVENNPELLKQ-----AYDNKEFQIIM 176          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_BRASB (Adenosylhomocysteinase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.624e-46
Identity = 94/166 (56.63%), Postives = 113/166 (68.07%), Query Frame = 1
Query:  163 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            ++ VKD+S A+FGR EI LAE EMPGLMA R E+GP QP KGA+I GSLHMTIQTAVLIETL ALGA++RW SCNI+STQDH               KGETL +YW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  PAS +   F  +L
Sbjct:    9 DYIVKDISLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGARIAGSLHMTIQTAVLIETLAALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLADYWDYTAKLFDWHGGGHPNMILDDGGDATMYVHLGLRAEN--GDTAFLDKPASEEEEVFFALL 172          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_BRAJA (Adenosylhomocysteinase OS=Bradyrhizobium japonicum GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.624e-46
Identity = 94/166 (56.63%), Postives = 111/166 (66.87%), Query Frame = 1
Query:  163 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            ++ VKD+S ADFGR E+ LAE EMPGLMA R EFGP QP KGA+I GSLHMTIQT VLIETL ALGA++RW SCNI+STQDH               KGETL EYW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    9 DYIVKDISLADFGRKELSLAETEMPGLMATREEFGPKQPLKGARIAGSLHMTIQTGVLIETLAALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTAKLFDWHGGGHPNMILDDGGDATMYVHLGLRAEN--GDTAFLDKPGSEEEEVFFALL 172          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCTU (Adenosylhomocysteinase OS=Mycobacterium tuberculosis GN=ahcY PE=1 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 7.345e-46
Identity = 95/181 (52.49%), Postives = 119/181 (65.75%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  G++    YEK G +P     D AE+++ L +
Sbjct:   17 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDPAEWKVFLNL 193          
The following BLAST results are available for this feature:
BLAST of FC931069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_MYCMM1.133e-4653.07Adenosylhomocysteinase OS=Mycobacterium marinum (s... [more]
SAHH_MYCLE2.525e-4653.59Adenosylhomocysteinase OS=Mycobacterium leprae GN=... [more]
SAHH_MYCLB2.525e-4653.59Adenosylhomocysteinase OS=Mycobacterium leprae (st... [more]
SAHH_PELLD4.306e-4660.27Adenosylhomocysteinase OS=Pelodictyon luteolum (st... [more]
SAHH_PELPB5.624e-4660.53Adenosylhomocysteinase OS=Pelodictyon phaeoclathra... [more]
SAHH_MYCBO5.624e-4653.04Adenosylhomocysteinase OS=Mycobacterium bovis GN=a... [more]
SAHH_DESVM5.624e-4655.15Adenosylhomocysteinase OS=Desulfovibrio vulgaris (... [more]
SAHH_BRASB5.624e-4656.63Adenosylhomocysteinase OS=Bradyrhizobium sp. (stra... [more]
SAHH_BRAJA5.624e-4656.63Adenosylhomocysteinase OS=Bradyrhizobium japonicum... [more]
SAHH_MYCTU7.345e-4652.49Adenosylhomocysteinase OS=Mycobacterium tuberculos... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A12EF PostHarvP1 Citrus clementina cDNA clone C34101A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931069 ID=FC931069|Name=FC931069|organism=Citrus clementina|type=EST|length=668bp
GGCTCACACCCACTCTATCTCTCTCGCTTGTACAATCATTCACTTTGTTT
GGTTGGTTTCCAAAGAGAGAGTAGAGTGCCCTCTCTTCCTTCTTCCTTTT
AGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAATCC
GCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTTCGG
CCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGGCTT
GCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATCACC
GGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCTCAC
CGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAACCC
AAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTTGCC
TGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGCCCT
GGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTGGTG
ACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTACGAG
AAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACAACGCCGAGTTTCA
GATTGTTTTGACTATCAT
back to top