FC931069

Overview
NameFC931069
Unique NameFC931069
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length668
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:1..670. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCTA (Adenosylhomocysteinase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 7.345e-46
Identity = 95/181 (52.49%), Postives = 119/181 (65.75%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  G++    YEK G +P     D AE+++ L +
Sbjct:   17 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDPAEWKVFLNL 193          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCBT (Adenosylhomocysteinase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 7.345e-46
Identity = 95/181 (52.49%), Postives = 119/181 (65.75%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  G++    YEK G +P     D AE+++ L +
Sbjct:   17 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDPAEWKVFLNL 193          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCBP (Adenosylhomocysteinase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 7.345e-46
Identity = 95/181 (52.49%), Postives = 119/181 (65.75%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  G++    YEK G +P     D AE+++ L +
Sbjct:   17 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDPAEWKVFLNL 193          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCSS (Adenosylhomocysteinase OS=Mycobacterium sp. (strain MCS) GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 9.593e-46
Identity = 95/183 (51.91%), Postives = 120/183 (65.57%), Query Frame = 1
Query:  145 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +S +G ++KV DLS A+FGR EI LAE EMPGLMA R E+    P KGA+I+GSLHMT+QTAVLIETL +LGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W PG   ++I+DDGGDAT+L+  G +    +EK G +P     D+AE+++ L +
Sbjct:   11 ESRNGIDYKVADLSLAEFGRKEIRLAEHEMPGLMALRREYAEVAPLKGARISGSLHMTVQTAVLIETLVSLGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPKGTPVFAWKGETLEEYWWAAEQMLTW-PGEPANMILDDGGDATMLVLRGAQ----FEKAGVVPPAEDDDSAEYKVFLNL 188          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCSK (Adenosylhomocysteinase OS=Mycobacterium sp. (strain KMS) GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 9.593e-46
Identity = 95/183 (51.91%), Postives = 120/183 (65.57%), Query Frame = 1
Query:  145 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +S +G ++KV DLS A+FGR EI LAE EMPGLMA R E+    P KGA+I+GSLHMT+QTAVLIETL +LGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W PG   ++I+DDGGDAT+L+  G +    +EK G +P     D+AE+++ L +
Sbjct:   11 ESRNGIDYKVADLSLAEFGRKEIRLAEHEMPGLMALRREYAEVAPLKGARISGSLHMTVQTAVLIETLVSLGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPKGTPVFAWKGETLEEYWWAAEQMLTW-PGEPANMILDDGGDATMLVLRGAQ----FEKAGVVPPAEDDDSAEYKVFLNL 188          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCSJ (Adenosylhomocysteinase OS=Mycobacterium sp. (strain JLS) GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 9.593e-46
Identity = 95/183 (51.91%), Postives = 120/183 (65.57%), Query Frame = 1
Query:  145 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +S +G ++KV DLS A+FGR EI LAE EMPGLMA R E+    P KGA+I+GSLHMT+QTAVLIETL +LGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W PG   ++I+DDGGDAT+L+  G +    +EK G +P     D+AE+++ L +
Sbjct:   11 ESRNGIDYKVADLSLAEFGRKEIRLAEHEMPGLMALRREYAEVAPLKGARISGSLHMTVQTAVLIETLVSLGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPKGTPVFAWKGETLEEYWWAAEQMLTW-PGEPANMILDDGGDATMLVLRGAQ----FEKAGVVPPAEDDDSAEYKVFLNL 188          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_CHLTE (Adenosylhomocysteinase OS=Chlorobium tepidum GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 9.593e-46
Identity = 91/155 (58.71%), Postives = 107/155 (69.03%), Query Frame = 1
Query:  163 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA 627
            ++KV D+S A++GR EIE+AE EMPGLMA R ++   +P  GA+I GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGETL EYWWCT + L++  G GP+LIVDDGGDATL+IH G K E       K P  A
Sbjct:    9 DYKVADISLAEWGRKEIEIAEKEMPGLMATRKKYEGKKPLAGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAIAAAGVPVFAWKGETLDEYWWCTRQILEFEGGLGPNLIVDDGGDATLMIHFGYKIENDPSMLDKTPGNA 163          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_CHLPD (Adenosylhomocysteinase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 9.593e-46
Identity = 88/141 (62.41%), Postives = 103/141 (73.05%), Query Frame = 1
Query:  166 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            +KV D+S A++GR EI++AE EMPGLMA R ++   +P KGA+I GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGETL EYWWCT + L++  G GP LIVDDGGDATL+IH G K E
Sbjct:   10 YKVADMSLAEWGRKEIDIAEKEMPGLMATRKKYAGQKPLKGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAIAKAGIPVFAWKGETLDEYWWCTRQILEFEGGKGPHLIVDDGGDATLMIHLGYKIE 150          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_CHLP8 (Adenosylhomocysteinase OS=Chlorobaculum parvum (strain NCIB 8327) GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 9.593e-46
Identity = 91/155 (58.71%), Postives = 107/155 (69.03%), Query Frame = 1
Query:  163 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA 627
            ++KV D+S A++GR EIE+AE EMPGLMA R ++   +P  GA+I GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGETL EYWWCT + L++  G GP+LIVDDGGDATL+IH G K E       K P  A
Sbjct:    9 DYKVADISLAEWGRKEIEIAEKEMPGLMATRKKYEGKKPLAGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAIAAAGVPVFAWKGETLDEYWWCTRQILEFEGGLGPNLIVDDGGDATLMIHLGYKIENDPSMLDKTPGNA 163          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_PELCD (Adenosylhomocysteinase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.253e-45
Identity = 96/164 (58.54%), Postives = 115/164 (70.12%), Query Frame = 1
Query:  166 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIV 657
            + VKD+  A++GR EI +AE EMPGLMA R E+  ++P  GA+ITGSLHMTIQTAVLIETL  LGA++RW SCNI+STQDH              +KGETL+EYW  T KAL +    GP LIVDDGGDATLLIH GV+ E  Y +TGK+P+  S DN E  IV
Sbjct:   10 YVVKDMGLAEWGRREIRMAEAEMPGLMAIREEYRGTKPLAGARITGSLHMTIQTAVLIETLAELGADLRWASCNIYSTQDHAAAAIAATGVPVFAYKGETLEEYWEYTFKALAYEE--GPQLIVDDGGDATLLIHRGVERERAYARTGKVPE-ISHDNKELSIV 170          
The following BLAST results are available for this feature:
BLAST of FC931069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_MYCTA7.345e-4652.49Adenosylhomocysteinase OS=Mycobacterium tuberculos... [more]
SAHH_MYCBT7.345e-4652.49Adenosylhomocysteinase OS=Mycobacterium bovis (str... [more]
SAHH_MYCBP7.345e-4652.49Adenosylhomocysteinase OS=Mycobacterium bovis (str... [more]
SAHH_MYCSS9.593e-4651.91Adenosylhomocysteinase OS=Mycobacterium sp. (strai... [more]
SAHH_MYCSK9.593e-4651.91Adenosylhomocysteinase OS=Mycobacterium sp. (strai... [more]
SAHH_MYCSJ9.593e-4651.91Adenosylhomocysteinase OS=Mycobacterium sp. (strai... [more]
SAHH_CHLTE9.593e-4658.71Adenosylhomocysteinase OS=Chlorobium tepidum GN=ah... [more]
SAHH_CHLPD9.593e-4662.41Adenosylhomocysteinase OS=Chlorobium phaeobacteroi... [more]
SAHH_CHLP89.593e-4658.71Adenosylhomocysteinase OS=Chlorobaculum parvum (st... [more]
SAHH_PELCD1.253e-4558.54Adenosylhomocysteinase OS=Pelobacter carbinolicus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A12EF PostHarvP1 Citrus clementina cDNA clone C34101A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931069 ID=FC931069|Name=FC931069|organism=Citrus clementina|type=EST|length=668bp
GGCTCACACCCACTCTATCTCTCTCGCTTGTACAATCATTCACTTTGTTT
GGTTGGTTTCCAAAGAGAGAGTAGAGTGCCCTCTCTTCCTTCTTCCTTTT
AGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAATCC
GCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTTCGG
CCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGGCTT
GCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATCACC
GGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCTCAC
CGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAACCC
AAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTTGCC
TGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGCCCT
GGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTGGTG
ACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTACGAG
AAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACAACGCCGAGTTTCA
GATTGTTTTGACTATCAT
back to top