FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_VITVI (S-adenosylmethionine synthetase 2 OS=Vitis vinifera GN=METK2 PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 3.346e-61
Identity = 112/119 (94.12%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCR IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLQQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCREIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_PETHY (S-adenosylmethionine synthetase 2 OS=Petunia hybrida GN=SAM2 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 3.346e-61
Identity = 111/119 (93.28%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACETCTKT+MVMVFGEITTKA VDYEKIVRDTCR IGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTSMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_POPDE (S-adenosylmethionine synthetase OS=Populus deltoides GN=METK PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 4.370e-61
Identity = 111/118 (94.07%), Postives = 117/118 (99.15%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFLFTSESVNEGHPDKLCD++SDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA+VDYEKIVRDTCR+IGFTSADVGLDAD+CKVLVNIEQQSPDIAQGVHGH +KRPEEIG
Sbjct:    3 ETFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRNIGFTSADVGLDADNCKVLVNIEQQSPDIAQGVHGHFSKRPEEIG 120          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_POPTR (S-adenosylmethionine synthetase 3 OS=Populus trichocarpa GN=METK3 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 4.370e-61
Identity = 111/118 (94.07%), Postives = 117/118 (99.15%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFLFTSESVNEGHPDKLCD++SDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA+VDYEKIVRDTCR+IGFTSADVGLDAD+CKVLVNIEQQSPDIAQGVHGH +KRPEEIG
Sbjct:    3 ETFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRNIGFTSADVGLDADNCKVLVNIEQQSPDIAQGVHGHFSKRPEEIG 120          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_WHEAT (S-adenosylmethionine synthetase OS=Triticum aestivum GN=SAMS PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 5.707e-61
Identity = 110/119 (92.44%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ++TFLFTSESVNEGHPDKLCD++SDAVLDACLA+DPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCR IGF S DVGLDADHCKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    4 VDTFLFTSESVNEGHPDKLCDQISDAVLDACLAEDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 122          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CARPA (S-adenosylmethionine synthetase OS=Carica papaya GN=SAMS PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 5.707e-61
Identity = 112/119 (94.12%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA+VDYEKIVRDTCRSIGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_ELAUM (S-adenosylmethionine synthetase 2 OS=Elaeagnus umbellata GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 5.707e-61
Identity = 111/119 (93.28%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACLAQDPDSKVACETC+KTNMVMVFGEITTKANVDYEKIVRDTCR+IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_TOBAC (S-adenosylmethionine synthetase 1 OS=Nicotiana tabacum GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 5.707e-61
Identity = 111/119 (93.28%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR IGFTSADVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_ELAUM (S-adenosylmethionine synthetase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 5.707e-61
Identity = 111/119 (93.28%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACLAQDPDSKVACETC+KTNMVMVFGEITTKANVDYEKIVRDTCR+IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_CATRO (S-adenosylmethionine synthetase 1 OS=Catharanthus roseus GN=SAMS1 PE=1 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 5.707e-61
Identity = 112/119 (94.12%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK2_VITVI3.346e-6194.12S-adenosylmethionine synthetase 2 OS=Vitis vinifer... [more]
METK2_PETHY3.346e-6193.28S-adenosylmethionine synthetase 2 OS=Petunia hybri... [more]
METK_POPDE4.370e-6194.07S-adenosylmethionine synthetase OS=Populus deltoid... [more]
METK3_POPTR4.370e-6194.07S-adenosylmethionine synthetase 3 OS=Populus trich... [more]
METK_WHEAT5.707e-6192.44S-adenosylmethionine synthetase OS=Triticum aestiv... [more]
METK_CARPA5.707e-6194.12S-adenosylmethionine synthetase OS=Carica papaya G... [more]
METK2_ELAUM5.707e-6193.28S-adenosylmethionine synthetase 2 OS=Elaeagnus umb... [more]
METK1_TOBAC5.707e-6193.28S-adenosylmethionine synthetase 1 OS=Nicotiana tab... [more]
METK1_ELAUM5.707e-6193.28S-adenosylmethionine synthetase 1 OS=Elaeagnus umb... [more]
METK1_CATRO5.707e-6194.12S-adenosylmethionine synthetase 1 OS=Catharanthus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top