FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK4_CAEEL (Probable S-adenosylmethionine synthetase 4 OS=Caenorhabditis elegans GN=sams-4 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 5.947e-34
Identity = 70/116 (60.34%), Postives = 90/116 (77.59%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            FLFTSESV+EGHPDK+CD++SDAVLDA LAQDP +KVACET TKT M+M+ GEIT+KA VDY+ +VR+  + IG+  +  G D   C VLV +EQQSP+IA GV  H+ K  +++G
Sbjct:    6 FLFTSESVSEGHPDKMCDQISDAVLDAHLAQDPHAKVACETVTKTGMIMLCGEITSKAVVDYQVLVRNVIKKIGYDDSSKGFDYKTCNVLVALEQQSPEIAAGV--HVDKDSDDVG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_CAEEL (Probable S-adenosylmethionine synthetase 3 OS=Caenorhabditis elegans GN=sams-3 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 5.947e-34
Identity = 70/116 (60.34%), Postives = 90/116 (77.59%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            FLFTSESV+EGHPDK+CD++SDAVLDA LAQDP +KVACET TKT M+M+ GEIT+KA VDY+ +VR+  + IG+  +  G D   C VLV +EQQSP+IA GV  H+ K  +++G
Sbjct:    6 FLFTSESVSEGHPDKMCDQISDAVLDAHLAQDPHAKVACETVTKTGMIMLCGEITSKAVVDYQVLVRNVIKKIGYDDSSKGFDYKTCNVLVALEQQSPEIAAGV--HVDKDSDDVG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LACPL (S-adenosylmethionine synthetase OS=Lactobacillus plantarum GN=metK PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 7.767e-34
Identity = 67/113 (59.29%), Postives = 87/113 (76.99%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LAQDP ++VA ET   T +V+VFGE++TKA VD +K+VRDT +SIG+     G D D+C VLV++++QSPDIAQGV   L  R
Sbjct:    3 ERHLFTSESVSEGHPDKIADQISDAILDAMLAQDPQARVAVETSVTTGLVLVFGEVSTKAYVDIQKVVRDTIKSIGYVDGQYGFDGDNCAVLVSLDEQSPDIAQGVDDSLETR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_HUMAN (S-adenosylmethionine synthetase isoform type-1 OS=Homo sapiens GN=MAT1A PE=1 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 7.767e-34
Identity = 70/116 (60.34%), Postives = 89/116 (76.72%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            F+FTSESV EGHPDK+CD++SDAVLDA L QDP++KVACET  KT MV++ GEIT+ A VDY+++VRDT + IG+  +  G D   C VLV +EQQSPDIAQ V  HL +  E++G
Sbjct:   18 FMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGEITSMAMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCV--HLDRNEEDVG 131          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK5_CAEEL (Probable S-adenosylmethionine synthetase 5 OS=Caenorhabditis elegans GN=sams-5 PE=2 SV=2)

HSP 1 Score: 142.895 bits (359), Expect = 1.014e-33
Identity = 68/105 (64.76%), Postives = 84/105 (80.00%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            FLFTSESV+EGHPDK+CD++SDAVLDA LAQDP +KVACET TKT M+M+ GEIT+KA VDY+ +VR+  + IG+  +  G D   C VLV +EQQSP+IA GVH
Sbjct:    6 FLFTSESVSEGHPDKMCDQISDAVLDAHLAQDPHAKVACETVTKTGMIMLCGEITSKAVVDYQVLVRNVIKKIGYDDSSKGFDYKTCNVLVALEQQSPEIAAGVH 110          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_RAT (S-adenosylmethionine synthetase isoform type-1 OS=Rattus norvegicus GN=Mat1a PE=1 SV=2)

HSP 1 Score: 142.895 bits (359), Expect = 1.014e-33
Identity = 69/116 (59.48%), Postives = 89/116 (76.72%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            F+FTSESV EGHPDK+CD++SDAVLDA L QDP++KVACET  KT MV++ GEIT+ A +DY+++VRDT + IG+  +  G D   C VLV +EQQSPDIAQ V  HL +  E++G
Sbjct:   19 FMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGEITSMAMIDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCV--HLDRNEEDVG 132          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_MOUSE (S-adenosylmethionine synthetase isoform type-1 OS=Mus musculus GN=Mat1a PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.014e-33
Identity = 70/116 (60.34%), Postives = 89/116 (76.72%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            F+FTSESV EGHPDK+CD++SDAVLDA L QDP++KVACET  KT MV++ GEIT+ A VDY+++VRDT + IG+  +  G D   C VLV +EQQSPDIAQ V  HL +  E++G
Sbjct:   19 FMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGEITSVAMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCV--HLDRNEEDVG 132          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_BOVIN (S-adenosylmethionine synthetase isoform type-1 OS=Bos taurus GN=MAT1A PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.952e-33
Identity = 69/116 (59.48%), Postives = 89/116 (76.72%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            F+FTSESV EGHPDK+CD++SDAVLDA L QDP++KVACET  KT MV++ GEIT+ A VDY+++VR+T + IG+  +  G D   C VLV +EQQSPDIAQ V  HL +  E++G
Sbjct:   19 FMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGEITSMAMVDYQRVVRETIQHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCV--HLDRNEEDVG 132          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PROMH (S-adenosylmethionine synthetase OS=Proteus mirabilis (strain HI4320) GN=metK PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.855e-33
Identity = 71/107 (66.36%), Postives = 84/107 (78.50%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M T LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GEITTKA VD E+I R T R IG+TS+D+G DA+ C V+  I +QSPDI QGV
Sbjct:    1 MTTHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTKAWVDIEEITRKTVREIGYTSSDMGFDANSCAVISAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_TREPS (S-adenosylmethionine synthetase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=metK PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 6.575e-33
Identity = 69/109 (63.30%), Postives = 85/109 (77.98%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHG 528
            METF FTSESV+EGHPDKLCD++SDAVLDACL+QDP S VACET   T+++++ GEI+T+A+++  +I RD    IG+ SADVGLDA    VL     QSPDIAQGVHG
Sbjct:    1 METF-FTSESVSEGHPDKLCDQISDAVLDACLSQDPHSCVACETFASTSLILIGGEISTRAHINLTQIARDVAADIGYVSADVGLDAASMAVLDMTHHQSPDIAQGVHG 108          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK4_CAEEL5.947e-3460.34Probable S-adenosylmethionine synthetase 4 OS=Caen... [more]
METK3_CAEEL5.947e-3460.34Probable S-adenosylmethionine synthetase 3 OS=Caen... [more]
METK_LACPL7.767e-3459.29S-adenosylmethionine synthetase OS=Lactobacillus p... [more]
METK1_HUMAN7.767e-3460.34S-adenosylmethionine synthetase isoform type-1 OS=... [more]
METK5_CAEEL1.014e-3364.76Probable S-adenosylmethionine synthetase 5 OS=Caen... [more]
METK1_RAT1.014e-3359.48S-adenosylmethionine synthetase isoform type-1 OS=... [more]
METK1_MOUSE1.014e-3360.34S-adenosylmethionine synthetase isoform type-1 OS=... [more]
METK1_BOVIN2.952e-3359.48S-adenosylmethionine synthetase isoform type-1 OS=... [more]
METK_PROMH3.855e-3366.36S-adenosylmethionine synthetase OS=Proteus mirabil... [more]
METK_TREPS6.575e-3363.30S-adenosylmethionine synthetase OS=Treponema palli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top