FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_TREPA (S-adenosylmethionine synthetase OS=Treponema pallidum GN=metK PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 6.575e-33
Identity = 69/109 (63.30%), Postives = 85/109 (77.98%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHG 528
            METF FTSESV+EGHPDKLCD++SDAVLDACL+QDP S VACET   T+++++ GEI+T+A+++  +I RD    IG+ SADVGLDA    VL     QSPDIAQGVHG
Sbjct:    1 METF-FTSESVSEGHPDKLCDQISDAVLDACLSQDPHSCVACETFASTSLILIGGEISTRAHINLTQIARDVAADIGYVSADVGLDAASMAVLDMTHHQSPDIAQGVHG 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PROM1 (S-adenosylmethionine synthetase OS=Prochlorococcus marinus (strain NATL1A) GN=metK PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 6.575e-33
Identity = 69/123 (56.10%), Postives = 92/123 (74.80%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSA-DVGLDADHCKVLVNIEQQSPDIAQGVH---GHLTKRPEEIG 558
            M  ++FTSESV EGHPDK+CD+VSDAVLDACL++DP S+VACE    T + ++ GEIT+KA VD+ K+VR+  +SIG+ SA D G DA+ C VLV ++QQS DIAQGV+    H T   +++G
Sbjct:    1 MSRYVFTSESVTEGHPDKICDQVSDAVLDACLSEDPTSRVACEAVVNTGLCLITGEITSKAEVDFNKLVREVIKSIGYRSASDGGFDANSCAVLVALDQQSSDIAQGVNEAEDHSTDPLDQVG 123          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_GEOSW (S-adenosylmethionine synthetase OS=Geobacillus sp. (strain WCH70) GN=metK PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 8.588e-33
Identity = 68/110 (61.82%), Postives = 82/110 (74.55%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV EGHPDK+CD++SDA+LDA L +DP+++VACET   T +V+V GEITT   VD  KIVRDT R IG+T A  G DAD C VL +I++QSPDIA GV   L  R
Sbjct:    7 LFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKIVRDTVREIGYTRAKYGFDADTCAVLTSIDEQSPDIAMGVDKALEAR 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PROMT (S-adenosylmethionine synthetase OS=Prochlorococcus marinus (strain NATL2A) GN=metK PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.465e-32
Identity = 68/123 (55.28%), Postives = 92/123 (74.80%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSA-DVGLDADHCKVLVNIEQQSPDIAQGVH---GHLTKRPEEIG 558
            M  ++FTSESV EGHPDK+CD+VSDAVLDACL++DP S+VACE    T + ++ GEIT+KA VD+ K+VR+  ++IG+ SA D G DA+ C VLV ++QQS DIAQGV+    H T   +++G
Sbjct:    1 MSRYVFTSESVTEGHPDKICDQVSDAVLDACLSEDPTSRVACEAVVNTGLCLITGEITSKAEVDFNKLVREVIKNIGYRSASDGGFDANSCAVLVALDQQSSDIAQGVNEAEDHSTDPLDQVG 123          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LACRJ (S-adenosylmethionine synthetase OS=Lactobacillus reuteri (strain JCM 1112) GN=metK PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.465e-32
Identity = 67/116 (57.76%), Postives = 86/116 (74.14%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            E  LFTSESV+EGHPDK+ D++SDA+LD  L +DPDS+VA ET   T +V+VFGE++TKA V+ ++IVRDT R IG+T    G DAD+C V+  I++QSPDIAQGV   L  R  E
Sbjct:    3 ERHLFTSESVSEGHPDKIADQISDAILDELLKKDPDSRVAVETSVTTGLVLVFGEVSTKAYVNIQQIVRDTIRKIGYTDGKYGFDADNCAVITAIDEQSPDIAQGVDDSLETREGE 118          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LACRD (S-adenosylmethionine synthetase OS=Lactobacillus reuteri (strain DSM 20016) GN=metK PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.465e-32
Identity = 67/116 (57.76%), Postives = 86/116 (74.14%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            E  LFTSESV+EGHPDK+ D++SDA+LD  L +DPDS+VA ET   T +V+VFGE++TKA V+ ++IVRDT R IG+T    G DAD+C V+  I++QSPDIAQGV   L  R  E
Sbjct:    3 ERHLFTSESVSEGHPDKIADQISDAILDELLKKDPDSRVAVETSVTTGLVLVFGEVSTKAYVNIQQIVRDTIRKIGYTDGKYGFDADNCAVITAIDEQSPDIAQGVDDSLETREGE 118          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_RHOBA (S-adenosylmethionine synthetase OS=Rhodopirellula baltica GN=metK PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.913e-32
Identity = 63/105 (60.00%), Postives = 84/105 (80.00%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            FLFTSESV+ GHPDKL DR+SD++LDA LAQDP S+VACET   T + ++ GEI++KA+VDYEKIVRDT  ++G+   D+G+D   C+V + ++ QSPDIAQGV+
Sbjct:    8 FLFTSESVSMGHPDKLADRISDSILDALLAQDPHSRVACETLVTTGLAVIAGEISSKADVDYEKIVRDTIVAVGYDDPDIGIDGKTCEVQIRLDAQSPDIAQGVN 112          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PSEA6 (S-adenosylmethionine synthetase OS=Pseudoalteromonas atlantica (strain T6c / BAA-1087) GN=metK PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.913e-32
Identity = 72/119 (60.50%), Postives = 87/119 (73.11%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GE+TT A VD E++ R+T R IG+T +D+G DAD C VL  I +QSPDI QGV      RPE+ G
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILKQDPKARVACETYVKTGMVMVGGEVTTNAWVDIEELTRNTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVD---RTRPEDQG 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_GEOKA (S-adenosylmethionine synthetase OS=Geobacillus kaustophilus GN=metK PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.913e-32
Identity = 67/110 (60.91%), Postives = 82/110 (74.55%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV EGHPDK+CD++SDA+LDA L +DP+++VACET   T +V+V GEITT   VD  +IVRDT R IG+T A  G DAD C VL +I++QSPDIA GV   L  R
Sbjct:    7 LFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPRIVRDTVREIGYTRAKYGFDADTCAVLTSIDEQSPDIAMGVDRALEAR 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_GEOSM (S-adenosylmethionine synthetase OS=Geobacter sp. (strain M21) GN=metK PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.263e-32
Identity = 65/107 (60.75%), Postives = 83/107 (77.57%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M+ F+FTSESV+EGHPDK+ D+VSDA+LDA L QDP S+VACET   T M ++ GEITT A +DY KIVR+T R IG+  + +G D + C VL +I++QSPDIAQGV
Sbjct:    3 MKDFIFTSESVSEGHPDKVADQVSDAILDAILTQDPKSRVACETMVTTGMAVIAGEITTNAIIDYPKIVRETIREIGYNDSAMGFDWETCAVLTSIDKQSPDIAQGV 109          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_TREPA6.575e-3363.30S-adenosylmethionine synthetase OS=Treponema palli... [more]
METK_PROM16.575e-3356.10S-adenosylmethionine synthetase OS=Prochlorococcus... [more]
METK_GEOSW8.588e-3361.82S-adenosylmethionine synthetase OS=Geobacillus sp.... [more]
METK_PROMT1.465e-3255.28S-adenosylmethionine synthetase OS=Prochlorococcus... [more]
METK_LACRJ1.465e-3257.76S-adenosylmethionine synthetase OS=Lactobacillus r... [more]
METK_LACRD1.465e-3257.76S-adenosylmethionine synthetase OS=Lactobacillus r... [more]
METK_RHOBA1.913e-3260.00S-adenosylmethionine synthetase OS=Rhodopirellula ... [more]
METK_PSEA61.913e-3260.50S-adenosylmethionine synthetase OS=Pseudoalteromon... [more]
METK_GEOKA1.913e-3260.91S-adenosylmethionine synthetase OS=Geobacillus kau... [more]
METK_GEOSM3.263e-3260.75S-adenosylmethionine synthetase OS=Geobacter sp. (... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top