FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEB9 (S-adenosylmethionine synthetase OS=Shewanella baltica (strain OS195) GN=metK PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.262e-32
Identity = 69/107 (64.49%), Postives = 82/107 (76.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA LAQDP ++VACET  KT MV+V GE+TT A VD E+I R T R IG+T +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEB8 (S-adenosylmethionine synthetase OS=Shewanella baltica (strain OS185) GN=metK PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.262e-32
Identity = 69/107 (64.49%), Postives = 82/107 (76.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA LAQDP ++VACET  KT MV+V GE+TT A VD E+I R T R IG+T +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEB5 (S-adenosylmethionine synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=metK PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.262e-32
Identity = 69/107 (64.49%), Postives = 82/107 (76.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA LAQDP ++VACET  KT MV+V GE+TT A VD E+I R T R IG+T +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEB2 (S-adenosylmethionine synthetase OS=Shewanella baltica (strain OS223) GN=metK PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.262e-32
Identity = 69/107 (64.49%), Postives = 82/107 (76.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA LAQDP ++VACET  KT MV+V GE+TT A VD E+I R T R IG+T +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_GEOUR (S-adenosylmethionine synthetase OS=Geobacter uraniireducens (strain Rf4) GN=metK PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.262e-32
Identity = 66/107 (61.68%), Postives = 83/107 (77.57%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M+ F+FTSESV+EGHPDK+ D+VSDA+LDA L QDP S+VACET   T M +V GEITT A VDY KIVR+T + IG+  + +G D + C VL +I++QSPDIAQGV
Sbjct:    3 MKDFIFTSESVSEGHPDKVADQVSDAILDAILTQDPKSRVACETLVTTGMTVVAGEITTNAIVDYPKIVRETIKEIGYNDSAMGFDWETCAVLTSIDKQSPDIAQGV 109          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_GEOTN (S-adenosylmethionine synthetase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=metK PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.262e-32
Identity = 67/110 (60.91%), Postives = 81/110 (73.64%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV EGHPDK+CD++SDA+LDA L +DP+++VACET   T +V+V GEITT   VD  +IVRDT R IG+T A  G DAD C VL  I++QSPDIA GV   L  R
Sbjct:    7 LFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPRIVRDTVREIGYTRAKFGFDADTCAVLTAIDEQSPDIAMGVDQALEAR 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PHOLL (S-adenosylmethionine synthetase OS=Photorhabdus luminescens subsp. laumondii GN=metK PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 5.566e-32
Identity = 68/107 (63.55%), Postives = 83/107 (77.57%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M T+LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GEITT A VD E+I R T R IG+ ++++G DA+ C VL  I +QSPDI QGV
Sbjct:    1 MTTYLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEEITRQTVREIGYVNSEMGFDANSCAVLSAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BACHD (S-adenosylmethionine synthetase OS=Bacillus halodurans GN=metK PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 5.566e-32
Identity = 64/110 (58.18%), Postives = 84/110 (76.36%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV EGHPDK+CD++SD++LD  L +DP+++VACET   T +V+V GEITT   VD  K+VRDT R+IG+T A  G D++ C VL +I++QSPDIAQGV+  L  R
Sbjct:    9 LFTSESVTEGHPDKICDQISDSILDEILKEDPNARVACETSVTTGLVLVAGEITTSTYVDIPKVVRDTIRNIGYTRAKYGFDSETCAVLTSIDEQSPDIAQGVNQALEAR 118          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SYNS9 (S-adenosylmethionine synthetase OS=Synechococcus sp. (strain CC9902) GN=metK PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 7.270e-32
Identity = 66/109 (60.55%), Postives = 84/109 (77.06%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADV-GLDADHCKVLVNIEQQSPDIAQGVH 525
            M  ++FTSESV EGHPDK+CD+VSDAVLDA LAQDP S+VACET   T + M+ GE+T+KA VD+  +VRD  + IG++ A   G DA+ C VLV ++QQSPDIAQGV+
Sbjct:    1 MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPASRVACETVVNTGLCMITGEVTSKAKVDFIHLVRDVIKEIGYSGARAGGFDANSCAVLVALDQQSPDIAQGVN 109          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEWM (S-adenosylmethionine synthetase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=metK PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 7.270e-32
Identity = 68/107 (63.55%), Postives = 82/107 (76.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GE+TT A VD E+I R+T R IG+T +D+G DAD C +L  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRNTVREIGYTHSDMGFDADSCAILNVIGKQSPDINQGV 107          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_SHEB94.262e-3264.49S-adenosylmethionine synthetase OS=Shewanella balt... [more]
METK_SHEB84.262e-3264.49S-adenosylmethionine synthetase OS=Shewanella balt... [more]
METK_SHEB54.262e-3264.49S-adenosylmethionine synthetase OS=Shewanella balt... [more]
METK_SHEB24.262e-3264.49S-adenosylmethionine synthetase OS=Shewanella balt... [more]
METK_GEOUR4.262e-3261.68S-adenosylmethionine synthetase OS=Geobacter urani... [more]
METK_GEOTN4.262e-3260.91S-adenosylmethionine synthetase OS=Geobacillus the... [more]
METK_PHOLL5.566e-3263.55S-adenosylmethionine synthetase OS=Photorhabdus lu... [more]
METK_BACHD5.566e-3258.18S-adenosylmethionine synthetase OS=Bacillus halodu... [more]
METK_SYNS97.270e-3260.55S-adenosylmethionine synthetase OS=Synechococcus s... [more]
METK_SHEWM7.270e-3263.55S-adenosylmethionine synthetase OS=Shewanella wood... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top