FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_GLOVI (S-adenosylmethionine synthetase OS=Gloeobacter violaceus GN=metK PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 9.495e-32
Identity = 66/117 (56.41%), Postives = 83/117 (70.94%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            M  +LF+SESV EGHPDK+CD++SD +LDA L QDP S+VA E    T MV+V GEITT ANV++ K+VRD  R IG+T AD G  AD C V + +++QSP+IAQGV   L  R  E
Sbjct:    1 MSRYLFSSESVTEGHPDKICDQISDTILDALLTQDPRSRVAAEVVVNTGMVVVTGEITTTANVNFTKLVRDKIREIGYTEADNGFSADSCAVFLALDEQSPEIAQGVSCALEVRTSE 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ALTMD (S-adenosylmethionine synthetase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=metK PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 9.495e-32
Identity = 67/107 (62.62%), Postives = 83/107 (77.57%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M T LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MV+V GE+TT A VD E++ R+T + IG+T +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MATHLFTSESVSEGHPDKIADQISDAVLDAILEQDPRARVACETYVKTGMVLVGGEVTTSAWVDIEELTRNTVKEIGYTHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_VIBSL (S-adenosylmethionine synthetase OS=Vibrio splendidus (strain LGP32) GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA + QDP ++VACET  KT MVMV GE+TT A VD E+I R+T R IG+  +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAIIEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDADSCAVLNTIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEPA (S-adenosylmethionine synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 68/107 (63.55%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GE+TT A VD E+I R T R IG+T +D+G DAD C +L  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRKTVRDIGYTHSDMGFDADSCAILNVIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHELP (S-adenosylmethionine synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 68/107 (63.55%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GE+TT A VD E++ R T R IG+T +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEELTRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEHH (S-adenosylmethionine synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 68/107 (63.55%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GE+TT A VD E+I R T R IG+T +D+G DAD C +L  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRKTVRDIGYTHSDMGFDADSCAILNVIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PSEHT (S-adenosylmethionine synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 72/119 (60.50%), Postives = 85/119 (71.43%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QD  ++VACET  KT MVMV GEITT A VD E+I R T R IG+T++D+G DAD C +L  I +QSPDI QGV       PEE G
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDSHARVACETYVKTGMVMVGGEITTSAWVDIEEITRKTIRDIGYTNSDMGFDADSCAILNTIGKQSPDINQGVD---RTSPEEQG 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LISW6 (S-adenosylmethionine synthetase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 65/110 (59.09%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV++GHPDK+ D++SDA+LDA +++DPD++VACET   T +V+V GEITT   VD  KIVRDT + IG+T A  G DA+ C VL  I++QSPDIAQGV   L  R
Sbjct:    7 LFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESR 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LISMO (S-adenosylmethionine synthetase OS=Listeria monocytogenes GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 65/110 (59.09%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV++GHPDK+ D++SDA+LDA +++DPD++VACET   T +V+V GEITT   VD  KIVRDT + IG+T A  G DA+ C VL  I++QSPDIAQGV   L  R
Sbjct:    7 LFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESR 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LISMH (S-adenosylmethionine synthetase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 65/110 (59.09%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV++GHPDK+ D++SDA+LDA +++DPD++VACET   T +V+V GEITT   VD  KIVRDT + IG+T A  G DA+ C VL  I++QSPDIAQGV   L  R
Sbjct:    7 LFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESR 116          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_GLOVI9.495e-3256.41S-adenosylmethionine synthetase OS=Gloeobacter vio... [more]
METK_ALTMD9.495e-3262.62S-adenosylmethionine synthetase OS=Alteromonas mac... [more]
METK_VIBSL1.240e-3162.62S-adenosylmethionine synthetase OS=Vibrio splendid... [more]
METK_SHEPA1.240e-3163.55S-adenosylmethionine synthetase OS=Shewanella peal... [more]
METK_SHELP1.240e-3163.55S-adenosylmethionine synthetase OS=Shewanella loih... [more]
METK_SHEHH1.240e-3163.55S-adenosylmethionine synthetase OS=Shewanella hali... [more]
METK_PSEHT1.240e-3160.50S-adenosylmethionine synthetase OS=Pseudoalteromon... [more]
METK_LISW61.240e-3159.09S-adenosylmethionine synthetase OS=Listeria welshi... [more]
METK_LISMO1.240e-3159.09S-adenosylmethionine synthetase OS=Listeria monocy... [more]
METK_LISMH1.240e-3159.09S-adenosylmethionine synthetase OS=Listeria monocy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top