FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LISMF (S-adenosylmethionine synthetase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 65/110 (59.09%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV++GHPDK+ D++SDA+LDA +++DPD++VACET   T +V+V GEITT   VD  KIVRDT + IG+T A  G DA+ C VL  I++QSPDIAQGV   L  R
Sbjct:    7 LFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESR 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LISMC (S-adenosylmethionine synthetase OS=Listeria monocytogenes serotype 4b (strain Clip81459) GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 65/110 (59.09%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV++GHPDK+ D++SDA+LDA +++DPD++VACET   T +V+V GEITT   VD  KIVRDT + IG+T A  G DA+ C VL  I++QSPDIAQGV   L  R
Sbjct:    7 LFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESR 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LISIN (S-adenosylmethionine synthetase OS=Listeria innocua GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 65/110 (59.09%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV++GHPDK+ D++SDA+LDA +++DPD++VACET   T +V+V GEITT   VD  KIVRDT + IG+T A  G DA+ C VL  I++QSPDIAQGV   L  R
Sbjct:    7 LFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESR 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_GEOMG (S-adenosylmethionine synthetase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 63/107 (58.88%), Postives = 85/107 (79.44%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M+ ++FTSESV+EGHPDK+ D+VSD++LDA LAQDP ++VACET   T M ++ GEITT A VDY K+VR+T R IG+  + +G D + C VLV+I++QSPDI+QGV
Sbjct:    3 MKDYIFTSESVSEGHPDKVADQVSDSILDAILAQDPRARVACETLVTTGMAVIAGEITTSAVVDYPKVVRETIREIGYNDSAMGFDWETCAVLVSIDKQSPDISQGV 109          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CLOBB (S-adenosylmethionine synthetase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=metK PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.240e-31
Identity = 62/103 (60.19%), Postives = 78/103 (75.73%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            LFTSESV EGHPDK+CD++SDA+LDA L +DP+++VACETCT T +VMV GEI+T   VD  K+VR+T R IG+  A  G D D C V+  I++QS DIA GV
Sbjct:    4 LFTSESVTEGHPDKMCDQISDAILDAILTKDPNARVACETCTTTGLVMVMGEISTNCYVDIPKVVRETVREIGYDRAKYGFDCDTCSVMTTIDEQSADIAMGV 106          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SYNSC (S-adenosylmethionine synthetase OS=Synechococcus sp. (strain CC9605) GN=metK PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.620e-31
Identity = 65/109 (59.63%), Postives = 84/109 (77.06%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADV-GLDADHCKVLVNIEQQSPDIAQGVH 525
            M  ++FTSESV EGHPDK+CD+VSDAVLDA LAQDP S+VACET   T + M+ GE+T+KA VD+  +VR+  + IG++ A   G DA+ C VLV ++QQSPDIAQGV+
Sbjct:    1 MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPSSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRNVIKEIGYSGARAGGFDANSCAVLVALDQQSPDIAQGVN 109          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEDO (S-adenosylmethionine synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=metK PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.620e-31
Identity = 68/107 (63.55%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MV+V GE+TT A VD E+I R T R IG+T +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SYNPX (S-adenosylmethionine synthetase OS=Synechococcus sp. (strain WH8102) GN=metK PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.115e-31
Identity = 65/108 (60.19%), Postives = 83/108 (76.85%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADV-GLDADHCKVLVNIEQQSPDIAQGV 522
            M  ++FTSESV EGHPDK+CD+VSDAVLDA LAQDP S+VACET   T + M+ GE+T+KA VD+  +VR+  + IG++ A   G DA+ C VLV ++QQSPDIAQGV
Sbjct:    1 MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPSSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRNVIKEIGYSGARAGGFDANSCAVLVALDQQSPDIAQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SYNPW (S-adenosylmethionine synthetase OS=Synechococcus sp. (strain WH7803) GN=metK PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.115e-31
Identity = 66/108 (61.11%), Postives = 82/108 (75.93%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADV-GLDADHCKVLVNIEQQSPDIAQGV 522
            M  ++FTSESV EGHPDK+CD+VSDAVLDA LAQD  S+VACET   T + M+ GE+T+KA VD+  +VRD  R IG++ A   G DA+ C VLV ++QQSPDIAQGV
Sbjct:    1 MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDSSSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRDVIREIGYSGARAGGFDANSCAVLVALDQQSPDIAQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PHOPR (S-adenosylmethionine synthetase OS=Photobacterium profundum GN=metK PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.115e-31
Identity = 70/119 (58.82%), Postives = 87/119 (73.11%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GEITT A VD E+I R+T R IG+ ++++G DA+ C VL  I +QSPDI QGV     + P E+G
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEEITRETIREIGYVNSEMGFDANSCAVLSAIGKQSPDINQGVD---REDPRELG 116          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_LISMF1.240e-3159.09S-adenosylmethionine synthetase OS=Listeria monocy... [more]
METK_LISMC1.240e-3159.09S-adenosylmethionine synthetase OS=Listeria monocy... [more]
METK_LISIN1.240e-3159.09S-adenosylmethionine synthetase OS=Listeria innocu... [more]
METK_GEOMG1.240e-3158.88S-adenosylmethionine synthetase OS=Geobacter metal... [more]
METK_CLOBB1.240e-3160.19S-adenosylmethionine synthetase OS=Clostridium bot... [more]
METK_SYNSC1.620e-3159.63S-adenosylmethionine synthetase OS=Synechococcus s... [more]
METK_SHEDO1.620e-3163.55S-adenosylmethionine synthetase OS=Shewanella deni... [more]
METK_SYNPX2.115e-3160.19S-adenosylmethionine synthetase OS=Synechococcus s... [more]
METK_SYNPW2.115e-3161.11S-adenosylmethionine synthetase OS=Synechococcus s... [more]
METK_PHOPR2.115e-3158.82S-adenosylmethionine synthetase OS=Photobacterium ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top