FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK4_VITVI (S-adenosylmethionine synthetase 4 OS=Vitis vinifera GN=METK4 PE=3 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 3.699e-60
Identity = 107/119 (89.92%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M+TFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTN+VM+FGEITTKAN+DYEKIVRDTCR++GF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 MDTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNLVMIFGEITTKANLDYEKIVRDTCRAVGFVSEDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_POPTR (S-adenosylmethionine synthetase 2 OS=Populus trichocarpa GN=METK2 PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 3.699e-60
Identity = 111/119 (93.28%), Postives = 113/119 (94.96%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD+VSDA+LDACL QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVR TCRSIGF S DVGLDAD C VLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRSTCRSIGFVSDDVGLDADKCNVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_ORYSJ (S-adenosylmethionine synthetase 3 OS=Oryza sativa subsp. japonica GN=METK3 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 4.831e-60
Identity = 108/119 (90.76%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ++TFLFTSESVNEGHPDKLCD++SDAVLDACLA+DP+SKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCR IGF S DVGLDA+HCKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    4 VDTFLFTSESVNEGHPDKLCDQISDAVLDACLAEDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDAEHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 122          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_ORYSJ (S-adenosylmethionine synthetase 2 OS=Oryza sativa subsp. japonica GN=SAM2 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 4.831e-60
Identity = 111/118 (94.07%), Postives = 112/118 (94.92%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFLFTSESVNEGHPDKLCD+VSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    4 ETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFVSDDVGLDADRCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 121          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_GOSHI (S-adenosylmethionine synthetase OS=Gossypium hirsutum GN=SAMS PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 6.310e-60
Identity = 109/119 (91.60%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACLAQDP+SKVACETC+KTNMVMVFGEITTKA+VDYEKIVRDTCR IGFTS DVGLDAD+CK LVNIEQQSPDIAQGVHGHL+KRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCSKTNMVMVFGEITTKADVDYEKIVRDTCRGIGFTSDDVGLDADNCKALVNIEQQSPDIAQGVHGHLSKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_PEA (S-adenosylmethionine synthetase 2 OS=Pisum sativum GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 6.310e-60
Identity = 109/118 (92.37%), Postives = 115/118 (97.46%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFLFTSESVNEGHPDKLCD++SDAVLDACL QDP+SKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCR+IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTKRPE+IG
Sbjct:    4 ETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEDIG 121          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PHALU (S-adenosylmethionine synthetase OS=Phaseolus lunatus GN=SAMS PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.241e-60
Identity = 109/118 (92.37%), Postives = 115/118 (97.46%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFLFTSESVNEGHPDKLCD++SDAVLDACL QDP+SKVACETCTKTN+VMVFGEITTKANVDYEKIVRDTCR+IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    3 ETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRNIGFISNDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 120          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_MEDTR (S-adenosylmethionine synthetase OS=Medicago truncatula GN=METK PE=3 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.241e-60
Identity = 109/118 (92.37%), Postives = 113/118 (95.76%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCR+IGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TKRPEE+G
Sbjct:    3 ETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEEVG 120          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_MEDFA (S-adenosylmethionine synthetase OS=Medicago falcata GN=SAMS PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.241e-60
Identity = 109/118 (92.37%), Postives = 115/118 (97.46%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFL+TSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVR+TCR+IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    4 ETFLYTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRNTCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 121          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BRARP (S-adenosylmethionine synthetase OS=Brassica rapa subsp. pekinensis GN=SAMS PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.241e-60
Identity = 110/119 (92.44%), Postives = 113/119 (94.96%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TKRPE+IG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIG 119          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK4_VITVI3.699e-6089.92S-adenosylmethionine synthetase 4 OS=Vitis vinifer... [more]
METK2_POPTR3.699e-6093.28S-adenosylmethionine synthetase 2 OS=Populus trich... [more]
METK3_ORYSJ4.831e-6090.76S-adenosylmethionine synthetase 3 OS=Oryza sativa ... [more]
METK2_ORYSJ4.831e-6094.07S-adenosylmethionine synthetase 2 OS=Oryza sativa ... [more]
METK_GOSHI6.310e-6091.60S-adenosylmethionine synthetase OS=Gossypium hirsu... [more]
METK2_PEA6.310e-6092.37S-adenosylmethionine synthetase 2 OS=Pisum sativum... [more]
METK_PHALU8.241e-6092.37S-adenosylmethionine synthetase OS=Phaseolus lunat... [more]
METK_MEDTR8.241e-6092.37S-adenosylmethionine synthetase OS=Medicago trunca... [more]
METK_MEDFA8.241e-6092.37S-adenosylmethionine synthetase OS=Medicago falcat... [more]
METK_BRARP8.241e-6092.44S-adenosylmethionine synthetase OS=Brassica rapa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top