FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK5_BRAJU (S-adenosylmethionine synthetase 5 OS=Brassica juncea GN=MSAMS5 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.241e-60
Identity = 110/119 (92.44%), Postives = 113/119 (94.96%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TKRPE+IG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_CATRO (S-adenosylmethionine synthetase 3 OS=Catharanthus roseus GN=SAMS3 PE=1 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.241e-60
Identity = 109/119 (91.60%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACETCTKTNMVMVFGEITTKA V+YEKIVRDTCR IGFTS DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKATVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_BRAJU (S-adenosylmethionine synthetase 3 OS=Brassica juncea GN=MSAMS3 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.241e-60
Identity = 110/119 (92.44%), Postives = 113/119 (94.96%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TKRPE+IG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_ATRNU (S-adenosylmethionine synthetase 3 OS=Atriplex nummularia GN=SAMS3 PE=1 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.241e-60
Identity = 108/119 (90.76%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ++TFLFTSESVNEGHPDKLCD++SDAVLDACLAQDP+SKVACETCTKTN+VMVFGEITTKANVDYEKIVR TCR IGF SADVGLDAD+CKVLVNIEQQSPDIAQGVHGHLT+RPEEIG
Sbjct:    5 VDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTRRPEEIG 123          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_BRAJU (S-adenosylmethionine synthetase 1 OS=Brassica juncea GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.241e-60
Identity = 110/119 (92.44%), Postives = 113/119 (94.96%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TKRPE+IG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_ACTCH (S-adenosylmethionine synthetase 1 OS=Actinidia chinensis GN=SAM1 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.241e-60
Identity = 108/119 (90.76%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M+TFLFTSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACE+CTKTNMVMVFGEITTKA V+YEKIVRDTCR IGFTS DVGLDADHCKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 MDTFLFTSESVNEGHPDKLCDQVSDAILDACLKQDPESKVACESCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_PICSI (S-adenosylmethionine synthetase 3 OS=Picea sitchensis GN=METK3 PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.076e-59
Identity = 109/119 (91.60%), Postives = 113/119 (94.96%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKA+VDYE+IVR TCR IGF S DVGLDADHCKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLTQDPDSKVACETCTKTNMVMVFGEITTKADVDYEQIVRKTCREIGFISDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_PINCO (S-adenosylmethionine synthetase 2 OS=Pinus contorta GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.076e-59
Identity = 109/119 (91.60%), Postives = 113/119 (94.96%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKA+VDYE+IVR TCR IGF S DVGLDADHCKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLTQDPDSKVACETCTKTNMVMVFGEITTKADVDYEQIVRKTCREIGFISDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_ARATH (S-adenosylmethionine synthetase 2 OS=Arabidopsis thaliana GN=SAM2 PE=1 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.076e-59
Identity = 109/119 (91.60%), Postives = 113/119 (94.96%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKA +DYEKIVRDTCRSIGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TKRPE+IG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATIDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_ACTCH (S-adenosylmethionine synthetase 2 OS=Actinidia chinensis GN=SAM2 PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.076e-59
Identity = 108/119 (90.76%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ME+FLFTSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACETCTKTNMVMVFGEITTKA V+YEKIVRDTCR IGFTS DVGLDADHCKVLVNIEQQSPDIAQGVHGHL+K+PEEIG
Sbjct:    1 MESFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFTSPDVGLDADHCKVLVNIEQQSPDIAQGVHGHLSKKPEEIG 119          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK5_BRAJU8.241e-6092.44S-adenosylmethionine synthetase 5 OS=Brassica junc... [more]
METK3_CATRO8.241e-6091.60S-adenosylmethionine synthetase 3 OS=Catharanthus ... [more]
METK3_BRAJU8.241e-6092.44S-adenosylmethionine synthetase 3 OS=Brassica junc... [more]
METK3_ATRNU8.241e-6090.76S-adenosylmethionine synthetase 3 OS=Atriplex numm... [more]
METK1_BRAJU8.241e-6092.44S-adenosylmethionine synthetase 1 OS=Brassica junc... [more]
METK1_ACTCH8.241e-6090.76S-adenosylmethionine synthetase 1 OS=Actinidia chi... [more]
METK3_PICSI1.076e-5991.60S-adenosylmethionine synthetase 3 OS=Picea sitchen... [more]
METK2_PINCO1.076e-5991.60S-adenosylmethionine synthetase 2 OS=Pinus contort... [more]
METK2_ARATH1.076e-5991.60S-adenosylmethionine synthetase 2 OS=Arabidopsis t... [more]
METK2_ACTCH1.076e-5990.76S-adenosylmethionine synthetase 2 OS=Actinidia chi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top