FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PELTS (S-adenosylmethionine synthetase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=metK PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.734e-28
Identity = 61/110 (55.45%), Postives = 77/110 (70.00%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV EGHPDK+ D++SDAVLDA   +DP ++VACET   T +V+V GEITT   VD  ++ R+T R IG+T A  G D D C V+ +I++QS DIAQGV   L  R
Sbjct:    5 LFTSESVTEGHPDKIADQISDAVLDAIFEKDPLARVACETLVTTGLVLVAGEITTDCYVDIPRVARETIREIGYTRAKYGFDCDTCAVITSIDEQSSDIAQGVDRALEVR 114          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_METCA (S-adenosylmethionine synthetase OS=Methylococcus capsulatus GN=metK PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.734e-28
Identity = 61/105 (58.10%), Postives = 78/105 (74.29%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            +F+FTSESV+EGHPDK+ D+VSDAVLDA LAQDP ++VA ET  KT MV++ GE+TT A VD E++VR     IG+ + ++G D   C VL  I +QSPDIA GV
Sbjct:    4 SFIFTSESVSEGHPDKIADQVSDAVLDAILAQDPKARVAVETLVKTGMVVLAGEVTTSAWVDTEELVRKVVHEIGYDNPEIGFDWQSCAVLTAIGKQSPDIAMGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CHLSY (S-adenosylmethionine synthetase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=metK PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.734e-28
Identity = 60/105 (57.14%), Postives = 79/105 (75.24%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEIT-TKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            F FTSESV+EGHPDK+CD++SDA+LDA L+ DP ++VA ET T T +++V GE+T  +  +  E+IVR T + IG+TSA+ G DAD C V+V I  QSPDIA GV
Sbjct:   11 FYFTSESVSEGHPDKMCDQISDAILDAFLSHDPKARVAVETATTTGLIVVLGEVTYERGYIPIEEIVRRTVKEIGYTSAEYGFDADTCGVMVAIHGQSPDIAMGV 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CHLAA (S-adenosylmethionine synthetase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=metK PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.734e-28
Identity = 60/105 (57.14%), Postives = 79/105 (75.24%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEIT-TKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            F FTSESV+EGHPDK+CD++SDA+LDA L+ DP ++VA ET T T +++V GE+T  +  +  E+IVR T + IG+TSA+ G DAD C V+V I  QSPDIA GV
Sbjct:   11 FYFTSESVSEGHPDKMCDQISDAILDAFLSHDPKARVAVETATTTGLIVVLGEVTYERGYIPIEEIVRRTVKEIGYTSAEYGFDADTCGVMVAIHGQSPDIAMGV 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ACIF5 (S-adenosylmethionine synthetase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metK PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.734e-28
Identity = 59/106 (55.66%), Postives = 79/106 (74.53%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            ++ LFTSESV+EGHPDK+ D++SDA+LDA LAQDP  +VA ET   T ++++ GEITT A VDY  + R T R IG+ S+D+G D   C V+  +++QSPDIAQGV
Sbjct:    3 KSHLFTSESVSEGHPDKVADQISDAILDAILAQDPRGRVAAETLITTGLIVLAGEITTTAVVDYADVARQTVRRIGYNSSDMGFDWASCAVVQTLDKQSPDIAQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ACIF2 (S-adenosylmethionine synthetase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / NCIB 8455) GN=metK PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.734e-28
Identity = 59/106 (55.66%), Postives = 79/106 (74.53%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            ++ LFTSESV+EGHPDK+ D++SDA+LDA LAQDP  +VA ET   T ++++ GEITT A VDY  + R T R IG+ S+D+G D   C V+  +++QSPDIAQGV
Sbjct:    3 KSHLFTSESVSEGHPDKVADQISDAILDAILAQDPRGRVAAETLITTGLIVLAGEITTTAVVDYADVARQTVRRIGYNSSDMGFDWASCAVVQTLDKQSPDIAQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CHRSD (S-adenosylmethionine synthetase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metK PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 4.876e-28
Identity = 66/118 (55.93%), Postives = 83/118 (70.34%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            E  LFTSESV+EGHPDK+ D++SDAVLDA +A+D  ++VACET  KT + +V GEITT A VD E +VR     IG+TS+DVG D + C VL  I +QS DIAQGV      +PE+ G
Sbjct:    3 EYSLFTSESVSEGHPDKIADQISDAVLDAIIARDKQARVACETMVKTGVAIVAGEITTSAWVDLEDLVRRVINDIGYTSSDVGFDGNTCGVLNLIGKQSVDIAQGVD---RSKPEDQG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BIFA0 (S-adenosylmethionine synthetase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=metK PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 4.876e-28
Identity = 60/106 (56.60%), Postives = 76/106 (71.70%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            E  L ++ESV EGHPDK+CD++SDA+LD  L QDP S VA ET        VFGE+T+K   D + IVRDT R IG+TS+ +GLDAD C VLV++ +QSP+I QGV
Sbjct:    3 EVKLISAESVTEGHPDKICDQISDAILDDMLRQDPHSHVAVETSATKGQFWVFGEVTSKGYSDIQSIVRDTVRRIGYTSSVIGLDADSCGVLVSLSEQSPEINQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_RHOFD (S-adenosylmethionine synthetase OS=Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118) GN=metK PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 6.369e-28
Identity = 59/104 (56.73%), Postives = 78/104 (75.00%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            FLFTSESV+EGHPDK+ D++SDA+LDA   QDP S+VA ET   T +V++ GEITT A+VDY ++ RDT + IG+ + + G+D   C VLV  ++QS DIAQGV
Sbjct:    5 FLFTSESVSEGHPDKVADQISDAILDAIFKQDPKSRVAAETLCNTGLVVLAGEITTNAHVDYIQVARDTLKRIGYDNTEYGIDYKGCAVLVAYDKQSNDIAQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_DESRM (S-adenosylmethionine synthetase OS=Desulfotomaculum reducens (strain MI-1) GN=metK PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 6.369e-28
Identity = 62/117 (52.99%), Postives = 80/117 (68.38%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            M   LFTSESV EGHPDK+ D++SDA+LD+ LA+DP ++VACET   T +V+V GEI+ +  VD  K+VR+T   IG+T A  G D D C VL  I++QSPDIA GV   L  +  E
Sbjct:    1 MSRKLFTSESVTEGHPDKVADQISDAILDSILAKDPMARVACETFVTTGLVLVGGEISCQCYVDIPKVVRETILEIGYTRAKYGFDGDTCAVLTAIDEQSPDIAMGVDKALEAKTGE 117          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_PELTS3.734e-2855.45S-adenosylmethionine synthetase OS=Pelotomaculum t... [more]
METK_METCA3.734e-2858.10S-adenosylmethionine synthetase OS=Methylococcus c... [more]
METK_CHLSY3.734e-2857.14S-adenosylmethionine synthetase OS=Chloroflexus au... [more]
METK_CHLAA3.734e-2857.14S-adenosylmethionine synthetase OS=Chloroflexus au... [more]
METK_ACIF53.734e-2855.66S-adenosylmethionine synthetase OS=Acidithiobacill... [more]
METK_ACIF23.734e-2855.66S-adenosylmethionine synthetase OS=Acidithiobacill... [more]
METK_CHRSD4.876e-2855.93S-adenosylmethionine synthetase OS=Chromohalobacte... [more]
METK_BIFA04.876e-2856.60S-adenosylmethionine synthetase OS=Bifidobacterium... [more]
METK_RHOFD6.369e-2856.73S-adenosylmethionine synthetase OS=Rhodoferax ferr... [more]
METK_DESRM6.369e-2852.99S-adenosylmethionine synthetase OS=Desulfotomaculu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top