FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAAC (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain COL) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAAB (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metK PE=3 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAA9 (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain JH9) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAA8 (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain NCTC 8325) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAA3 (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain USA300) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAA2 (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain JH1) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAA1 (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PSEPF (S-adenosylmethionine synthetase OS=Pseudomonas fluorescens (strain Pf0-1) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 66/118 (55.93%), Postives = 83/118 (70.34%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            E  LFTSESV+EGHPDK+ D++SDAVLDA +AQD  ++VA ET  KT + +V GE+TT A VD E+IVRD    IG+TS+DVG D   C V+  I +QSPDI QGV      +PE+ G
Sbjct:    3 EYSLFTSESVSEGHPDKIADQISDAVLDAIIAQDKHARVAVETLVKTGVAIVAGEVTTSAWVDLEQIVRDVICDIGYTSSDVGFDGATCGVMNIIGKQSPDINQGVD---RAKPEDQG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PSEF5 (S-adenosylmethionine synthetase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 66/118 (55.93%), Postives = 83/118 (70.34%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            E  LFTSESV+EGHPDK+ D++SDAVLDA +AQD  ++VA ET  KT + +V GE+TT A VD E+IVRD    IG+TS+DVG D   C V+  I +QSPDI QGV      +PE+ G
Sbjct:    3 EYSLFTSESVSEGHPDKIADQISDAVLDAIIAQDKHARVAVETLVKTGVAIVAGEVTTSAWVDLEQIVRDVICDIGYTSSDVGFDGATCGVMNIIGKQSPDINQGVD---RAKPEDQG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_MANSM (S-adenosylmethionine synthetase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 62/107 (57.94%), Postives = 76/107 (71.03%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M ++LFTSESV+EGHPDK+ D++SDAVLD  L QDP ++VACET  KT M +V GEITT A VD E I R     IG+TS+++G D   C VL  I +QS DI QGV
Sbjct:    1 MSSYLFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIEYIARQVICDIGYTSSEMGFDGHSCAVLNGIGKQSSDINQGV 107          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_STAAC8.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAAB8.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAA98.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAA88.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAA38.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAA28.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAA18.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_PSEPF8.318e-2855.93S-adenosylmethionine synthetase OS=Pseudomonas flu... [more]
METK_PSEF58.318e-2855.93S-adenosylmethionine synthetase OS=Pseudomonas flu... [more]
METK_MANSM8.318e-2857.94S-adenosylmethionine synthetase OS=Mannheimia succ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top