FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRPG (S-adenosylmethionine synthetase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=metK PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 61/113 (53.98%), Postives = 80/113 (70.80%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+T A +D  ++VRDT   IG+T A+ G  A+   V  ++ +QS DIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRPF (S-adenosylmethionine synthetase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=metK PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 61/113 (53.98%), Postives = 80/113 (70.80%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+T A +D  ++VRDT   IG+T A+ G  A+   V  ++ +QS DIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRPD (S-adenosylmethionine synthetase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=metK PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 61/113 (53.98%), Postives = 80/113 (70.80%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+T A +D  ++VRDT   IG+T A+ G  A+   V  ++ +QS DIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRPC (S-adenosylmethionine synthetase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=metK PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 61/113 (53.98%), Postives = 80/113 (70.80%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+T A +D  ++VRDT   IG+T A+ G  A+   V  ++ +QS DIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRPB (S-adenosylmethionine synthetase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=metK PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 61/113 (53.98%), Postives = 80/113 (70.80%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+T A +D  ++VRDT   IG+T A+ G  A+   V  ++ +QS DIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRP8 (S-adenosylmethionine synthetase OS=Streptococcus pyogenes serotype M18 GN=metK PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 61/113 (53.98%), Postives = 80/113 (70.80%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+T A +D  ++VRDT   IG+T A+ G  A+   V  ++ +QS DIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRP6 (S-adenosylmethionine synthetase OS=Streptococcus pyogenes serotype M6 GN=metK PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 61/113 (53.98%), Postives = 80/113 (70.80%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+T A +D  ++VRDT   IG+T A+ G  A+   V  ++ +QS DIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRP3 (S-adenosylmethionine synthetase OS=Streptococcus pyogenes serotype M3 GN=metK PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 61/113 (53.98%), Postives = 80/113 (70.80%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+T A +D  ++VRDT   IG+T A+ G  A+   V  ++ +QS DIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_RICTY (S-adenosylmethionine synthetase OS=Rickettsia typhi GN=metK PE=3 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 61/119 (51.26%), Postives = 79/119 (66.39%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ME F+FTSESV+EGHPDK+ D++SDAVLD  L  DP+ +VACET   T +V+V GEITT   VD E++VR+    IG+ +   G D   C V+ +I +QSPDIA G+        EEIG
Sbjct:    1 MENFVFTSESVSEGHPDKIADQISDAVLDEILKHDPNGRVACETFVTTGLVLVGGEITTNTYVDIEQVVRNKIHEIGYNNPSYGFDGSCCAVISSIVKQSPDIAMGID---NANEEEIG 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_THEM4 (S-adenosylmethionine synthetase OS=Thermosipho melanesiensis (strain BI429 / DSM 12029) GN=metK PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.853e-27
Identity = 62/114 (54.39%), Postives = 77/114 (67.54%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEI 555
            LFTSESV EGHPDK+ D++SDA+LDA L QDP S+VA ET   T + +V GE+TT+A VD + IVR T   IG+T A  G D + C VL +I  QSPDIA GV   L  +  E+
Sbjct:    4 LFTSESVTEGHPDKVADQISDAILDAMLEQDPRSRVAVETLVTTGIAIVSGEVTTRAYVDIQDIVRKTIMEIGYTRAKYGFDGETCAVLSSIHSQSPDIAMGVDKALEAKEGEL 117          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_STRPG1.419e-2753.98S-adenosylmethionine synthetase OS=Streptococcus p... [more]
METK_STRPF1.419e-2753.98S-adenosylmethionine synthetase OS=Streptococcus p... [more]
METK_STRPD1.419e-2753.98S-adenosylmethionine synthetase OS=Streptococcus p... [more]
METK_STRPC1.419e-2753.98S-adenosylmethionine synthetase OS=Streptococcus p... [more]
METK_STRPB1.419e-2753.98S-adenosylmethionine synthetase OS=Streptococcus p... [more]
METK_STRP81.419e-2753.98S-adenosylmethionine synthetase OS=Streptococcus p... [more]
METK_STRP61.419e-2753.98S-adenosylmethionine synthetase OS=Streptococcus p... [more]
METK_STRP31.419e-2753.98S-adenosylmethionine synthetase OS=Streptococcus p... [more]
METK_RICTY1.419e-2751.26S-adenosylmethionine synthetase OS=Rickettsia typh... [more]
METK_THEM41.853e-2754.39S-adenosylmethionine synthetase OS=Thermosipho mel... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top