FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CAMSI (S-adenosylmethionine synthetase OS=Camellia sinensis GN=SAM PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.836e-59
Identity = 110/119 (92.44%), Postives = 114/119 (95.80%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QD DSKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR+IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDQDSKVACETCTKTNMVMVFGEITTKAAVDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_PICSI (S-adenosylmethionine synthetase 2 OS=Picea sitchensis GN=METK2 PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.836e-59
Identity = 108/119 (90.76%), Postives = 113/119 (94.96%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKA++DYE+IVR TCR IGF S DVGLDADHCKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLIQDPDSKVACETCTKTNMVMVFGEITTKADIDYEQIVRKTCREIGFISDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_VITVI (S-adenosylmethionine synthetase 1 OS=Vitis vinifera GN=METK1 PE=3 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.836e-59
Identity = 108/119 (90.76%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M+TFLFTSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACETCTKTNMVMVFGEITTKA V+YEKIVRDTCR IGF SADVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 MDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_DENCR (S-adenosylmethionine synthetase OS=Dendrobium crumenatum GN=SAMS PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.398e-59
Identity = 106/119 (89.08%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ++TFLFTSESVNEGHPDKLCD++SDA+LDACL QDPDSKVACETC+KTNMVM+FGEITTKANVDYEKIVRDTCR+IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    4 VDTFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCSKTNMVMIFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 122          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_BRAJU (S-adenosylmethionine synthetase 2 OS=Brassica juncea GN=MSAMS2 PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 3.132e-59
Identity = 107/119 (89.92%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ME+FLFTSESVNEGHPDKLCD++SDA+LDACL QDP+SKVACETCTKTNMVMVFGEITTKANVDYEKIVR+TCR IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 MESFLFTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRETCREIGFISDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_POPTR (S-adenosylmethionine synthetase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 3.132e-59
Identity = 108/119 (90.76%), Postives = 112/119 (94.12%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTK  +DYEKIVRDTCR+IGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKGKIDYEKIVRDTCRNIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK4_ARATH (S-adenosylmethionine synthetase 4 OS=Arabidopsis thaliana GN=METK4 PE=1 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 4.090e-59
Identity = 106/119 (89.08%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ME+FLFTSESVNEGHPDKLCD++SDA+LDACL QDP+SKVACETCTKTNMVMVFGEITTKANVDYE+IVR TCR IGF SADVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTK+PEE+G
Sbjct:    1 MESFLFTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVDYEQIVRKTCREIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEVG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_VITVI (S-adenosylmethionine synthetase 3 OS=Vitis vinifera GN=METK3 PE=3 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 4.090e-59
Identity = 107/119 (89.92%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M+TFLFTSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF SADVGLDAD+CKVLVNIEQQSPDIAQGVHGHL+K+PEEIG
Sbjct:    1 MDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_PETHY (S-adenosylmethionine synthetase 3 OS=Petunia hybrida GN=SAM3 PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 5.342e-59
Identity = 108/119 (90.76%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDP+SKVACETCTKTN+VMVFGEITTKANVDYEKIVRDTCR+IGF S DVGLDAD+CKVLV IEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRNIGFISDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKQPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_ARATH (S-adenosylmethionine synthetase 1 OS=Arabidopsis thaliana GN=SAM1 PE=1 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 5.342e-59
Identity = 109/119 (91.60%), Postives = 112/119 (94.12%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR+IGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TK PEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRAIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKCPEEIG 119          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_CAMSI1.836e-5992.44S-adenosylmethionine synthetase OS=Camellia sinens... [more]
METK2_PICSI1.836e-5990.76S-adenosylmethionine synthetase 2 OS=Picea sitchen... [more]
METK1_VITVI1.836e-5990.76S-adenosylmethionine synthetase 1 OS=Vitis vinifer... [more]
METK_DENCR2.398e-5989.08S-adenosylmethionine synthetase OS=Dendrobium crum... [more]
METK2_BRAJU3.132e-5989.92S-adenosylmethionine synthetase 2 OS=Brassica junc... [more]
METK1_POPTR3.132e-5990.76S-adenosylmethionine synthetase 1 OS=Populus trich... [more]
METK4_ARATH4.090e-5989.08S-adenosylmethionine synthetase 4 OS=Arabidopsis t... [more]
METK3_VITVI4.090e-5989.92S-adenosylmethionine synthetase 3 OS=Vitis vinifer... [more]
METK3_PETHY5.342e-5990.76S-adenosylmethionine synthetase 3 OS=Petunia hybri... [more]
METK1_ARATH5.342e-5991.60S-adenosylmethionine synthetase 1 OS=Arabidopsis t... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top