FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_DICDI (S-adenosylmethionine synthetase OS=Dictyostelium discoideum GN=metK PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.119e-40
Identity = 83/120 (69.17%), Postives = 96/120 (80.00%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH-GHLTKRPEEIG 558
            M ++LFTSESV EGHPDK+CD+VSDAVLDACLAQDP SKVACET TKT MVM+ GEITTKANVDY+K+VR+  + IG+  +  G D   C VLV IEQQSPDIAQGVH G +   PE+IG
Sbjct:    1 MSSYLFTSESVTEGHPDKICDQVSDAVLDACLAQDPLSKVACETATKTGMVMILGEITTKANVDYQKVVREAVKKIGYDDSSKGFDYKTCNVLVAIEQQSPDIAQGVHIGKV--NPEDIG 118          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_YEAST (S-adenosylmethionine synthetase 1 OS=Saccharomyces cerevisiae GN=SAM1 PE=1 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 1.909e-40
Identity = 82/117 (70.09%), Postives = 93/117 (79.49%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            TFLFTSESV EGHPDK+CD+VSDA+LDACLA+DP SKVACET  KT M+MVFGEITTKA +DY+KIVRDT + IG+  +  G D   C VLV IEQQSPDIAQGVH    K  E+IG
Sbjct:    4 TFLFTSESVGEGHPDKICDQVSDAILDACLAEDPHSKVACETAAKTGMIMVFGEITTKAQLDYQKIVRDTIKKIGYDDSAKGFDYKTCNVLVAIEQQSPDIAQGVHEE--KDLEDIG 118          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SCHPO (S-adenosylmethionine synthetase OS=Schizosaccharomyces pombe GN=sam1 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.756e-39
Identity = 76/118 (64.41%), Postives = 95/118 (80.51%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            +TFLFTSESV EGHPDK+CD++SDA+LDACL  DP SKVACET +KT MVMVFGEITT++ +DY+K++R+T +SIG+  ++ G D   C VLV IEQQSPDIAQG+  H  K  EE+G
Sbjct:    3 QTFLFTSESVGEGHPDKICDQISDAILDACLKDDPFSKVACETASKTGMVMVFGEITTRSQIDYQKVIRNTIKSIGYDDSEKGFDYKTCNVLVAIEQQSPDIAQGL--HYEKALEELG 118          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_YEAST (S-adenosylmethionine synthetase 2 OS=Saccharomyces cerevisiae GN=SAM2 PE=1 SV=3)

HSP 1 Score: 160.999 bits (406), Expect = 3.600e-39
Identity = 79/118 (66.95%), Postives = 93/118 (78.81%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            +TFLFTSESV EGHPDK+CD+VSDA+LDACL QDP SKVACET  KT M+MVFGEITTKA +DY++IVRDT + IG+  +  G D   C VLV IEQQSPDIAQG+  H  K  E++G
Sbjct:    5 KTFLFTSESVGEGHPDKICDQVSDAILDACLEQDPFSKVACETAAKTGMIMVFGEITTKARLDYQQIVRDTIKKIGYDDSAKGFDYKTCNVLVAIEQQSPDIAQGL--HYEKSLEDLG 120          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ACACA (S-adenosylmethionine synthetase OS=Acanthamoeba castellanii GN=metK PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 6.140e-39
Identity = 74/107 (69.16%), Postives = 89/107 (83.18%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            +T LFTSE V+E HPDKLCD+VSDA+LDACLA DP SKVACET +KT MVMVFGEITTK++ DY+K++R+T + IGFT + +G D   C +LV IEQQSPDIAQGVH
Sbjct:    5 KTLLFTSECVSESHPDKLCDQVSDAILDACLANDPYSKVACETASKTGMVMVFGEITTKSSFDYQKVIRETVKRIGFTDSSIGFDYKTCNILVAIEQQSPDIAQGVH 111          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LEIIN (S-adenosylmethionine synthetase OS=Leishmania infantum GN=METK PE=2 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 8.019e-39
Identity = 78/107 (72.90%), Postives = 89/107 (83.18%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            + + LF+SE V EGHPDKLCD+VSDAVLDACLA DP SKVACE+C KT MVMVFGEITTKA +DY+KIVR+T + IGF SAD GLD + C VLV IEQQSPDI QG+
Sbjct:    3 VHSILFSSEHVTEGHPDKLCDQVSDAVLDACLAGDPFSKVACESCAKTGMVMVFGEITTKAVLDYQKIVRNTIKDIGFDSADKGLDYESCNVLVAIEQQSPDICQGL 109          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ASCIM (S-adenosylmethionine synthetase OS=Ascobolus immersus PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 5.198e-38
Identity = 78/117 (66.67%), Postives = 93/117 (79.49%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            +FLFTSESV EGHPDK+ D+VSDAVLDACLA+DP SKVACET TKT M+MVFGEITTKA++DY+KI+R+  + IG+  +  G D   C VLV IEQQSPDIAQG+  H  K  EE+G
Sbjct:   13 SFLFTSESVGEGHPDKIADQVSDAVLDACLAEDPLSKVACETATKTGMIMVFGEITTKAHLDYQKIIRNAVKDIGYDDSAKGFDYKTCNVLVAIEQQSPDIAQGL--HYEKALEELG 127          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_NEUCR (S-adenosylmethionine synthetase OS=Neurospora crassa GN=eth-1 PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 8.866e-38
Identity = 76/117 (64.96%), Postives = 92/117 (78.63%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            TFLFTSESV EGHPDK+ D+VSDA+LDACLA+DP SKVACET TKT M+MVFGEITTKA +DY+K+VR+  + IG+  +  G D   C +LV IE+QSPDIAQG+  HL  R E +G
Sbjct:   16 TFLFTSESVGEGHPDKIADQVSDAILDACLAEDPLSKVACETATKTGMIMVFGEITTKAKLDYQKVVRNAIKDIGYDDSSKGFDYKTCNLLVAIEEQSPDIAQGL--HLDDRLENLG 130          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_PONAB (S-adenosylmethionine synthetase isoform type-2 OS=Pongo abelii GN=MAT2A PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.852e-36
Identity = 73/117 (62.39%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            TFLFTSESV EGHPDK+CD++SDAVLDA L QDPD+KVACET  KT M+++ GEIT++A VDY+K+VR+  + IG+  +  G D   C VLV +EQQSPDIAQGV  HL +  E+IG
Sbjct:   17 TFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGEITSRAAVDYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV--HLDRNEEDIG 131          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_MACFA (S-adenosylmethionine synthetase isoform type-2 OS=Macaca fascicularis GN=MAT2A PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.852e-36
Identity = 73/117 (62.39%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            TFLFTSESV EGHPDK+CD++SDAVLDA L QDPD+KVACET  KT M+++ GEIT++A VDY+K+VR+  + IG+  +  G D   C VLV +EQQSPDIAQGV  HL +  E+IG
Sbjct:   17 TFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGEITSRAAVDYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV--HLDRNEEDIG 131          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_DICDI1.119e-4069.17S-adenosylmethionine synthetase OS=Dictyostelium d... [more]
METK1_YEAST1.909e-4070.09S-adenosylmethionine synthetase 1 OS=Saccharomyces... [more]
METK_SCHPO2.756e-3964.41S-adenosylmethionine synthetase OS=Schizosaccharom... [more]
METK2_YEAST3.600e-3966.95S-adenosylmethionine synthetase 2 OS=Saccharomyces... [more]
METK_ACACA6.140e-3969.16S-adenosylmethionine synthetase OS=Acanthamoeba ca... [more]
METK_LEIIN8.019e-3972.90S-adenosylmethionine synthetase OS=Leishmania infa... [more]
METK_ASCIM5.198e-3866.67S-adenosylmethionine synthetase OS=Ascobolus immer... [more]
METK_NEUCR8.866e-3864.96S-adenosylmethionine synthetase OS=Neurospora cras... [more]
METK2_PONAB2.852e-3662.39S-adenosylmethionine synthetase isoform type-2 OS=... [more]
METK2_MACFA2.852e-3662.39S-adenosylmethionine synthetase isoform type-2 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top